KEGG   Solanum pennellii: 107001612
Entry
107001612         CDS       T04130                                 

Definition
(RefSeq) flap endonuclease 1 isoform X1
  KO
K04799  flap endonuclease-1 [EC:3.-.-.-]
Organism
spen  Solanum pennellii
Pathway
spen03030  DNA replication
spen03410  Base excision repair
spen03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107001612
   03410 Base excision repair
    107001612
   03450 Non-homologous end-joining
    107001612
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spen03032]
    107001612
   03400 DNA repair and recombination proteins [BR:spen03400]
    107001612
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spen04147]
    107001612
Enzymes [BR:spen01000]
 3. Hydrolases
  3.-  
   3.-.-  
    3.-.-.-  
     107001612
DNA replication proteins [BR:spen03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    107001612
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     107001612
DNA repair and recombination proteins [BR:spen03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     107001612
Exosome [BR:spen04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107001612
SSDB
Motif
Pfam: XPG_N XPG_I 5_3_exonuc HHH_5 5_3_exonuc_N HHH_2
Other DBs
NCBI-GeneID: 107001612
NCBI-ProteinID: XP_015055104
LinkDB
Position
1
AA seq 411 aa
MGIKGLMKLLADNAPSGMKEQKFESYFGRKIAIDASMSIYQFLIVVGRSGTEMLTNEAGE
TTSHLVGMFSRTIRLLEAGIKPVYVFDGKPPDLKKQELAKRYSRREDATDDLAKATESGN
KEDIEKFSKRTVKVTSQHNDDCKKLLRLMGVPAVEAPSEAEAQCAALCKAEKVYAVASED
MDSLTFGAPKFLRHLMDPSSKKIPVMEFDISKVLEGLELSMDQFIDLCILCGCDYCDSIR
GIGPQTALKLVRQHGSMESILENINKERYQIPDDWPYEEARRLFKEPLVVTDDEQTELKW
AAPDEEGLVNFLVKENGFNIDRVTKAIEKIKTAKNKSSQGRLESFFKPVSTSAPVKRKGT
KCVLVYPSPVTKFKTLSLRSRPGVLGRLIFPSLELGSNYSVPLSRHFCFGI
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgggaatcaagggtttaatgaagcttttggctgacaatgctccaagtggaatgaaggag
cagaagttcgagagctatttcggccgtaaaatagccatcgacgctagtatgagcatttat
cagttcctgattgtagtaggacgaagcggtacggaaatgctcactaacgaagctggggaa
actactagtcatttggtcgggatgttttcgcggacgattaggcttttggaagctggaatc
aagccagtttatgtttttgatggcaagccccctgatttgaagaaacaagaacttgcaaaa
cgttactctagaagggaagatgccacagatgacttggctaaggctacagagagtggcaac
aaggaggatattgagaaattcagcaagagaacagtaaaggttacgtcacaacacaatgat
gactgcaaaaaacttctcagactaatgggggtacctgctgttgaggctccttctgaagca
gaggctcagtgtgccgcactttgcaaggcagaaaaggtttatgctgtggcctcagaagat
atggattccttaacttttggagctccaaagtttcttcgccatttaatggatcctagctcc
aaaaagataccagtgatggaatttgatatctccaaggtattggagggacttgaacttagt
atggatcagttcatagacttgtgcattctttgtggatgtgattactgtgatagcatccga
ggcatagggccccagacggctttgaagcttgtacgccaacatgggtcaatggagagcata
ttagagaatattaacaaagagagatatcaaatacctgatgattggccttatgaagaggct
aggcggctcttcaaggaaccattagttgttacagatgatgagcaaactgaactaaaatgg
gctgctcctgatgaagaagggttggttaactttctggtaaaggaaaatggattcaacatt
gatagagttacaaaggcaatagaaaagatcaagacagccaagaacaaatcttctcagggg
cggttagaatcattctttaaaccagttagcacatctgctccagttaaaagaaaggggact
aaatgtgttcttgtatatccgagtcctgttaccaagtttaagacactctctttacgatcc
agacctggtgtccttggaaggctaatcttcccatctttagaattggggtcgaattactcc
gtgccgttatccagacacttctgcttcggcatatga

DBGET integrated database retrieval system