KEGG   Solanum pennellii: 107002537
Entry
107002537         CDS       T04130                                 

Definition
(RefSeq) uncharacterized protein LOC107002537
  KO
K01246  DNA-3-methyladenine glycosylase I [EC:3.2.2.20]
Organism
spen  Solanum pennellii
Pathway
spen03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    107002537
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spen03400]
    107002537
Enzymes [BR:spen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.20  DNA-3-methyladenine glycosylase I
     107002537
DNA repair and recombination proteins [BR:spen03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     107002537
SSDB
Motif
Pfam: Adenine_glyco
Other DBs
NCBI-GeneID: 107002537
NCBI-ProteinID: XP_015056082
LinkDB
Position
10
AA seq 348 aa
MCSYKFKKQGGVVDISSQSISHINGRPVLQPYNNSHKKNNSCNVKISPSPKIKKVNVLDT
NTSNEKSMTPKITKSSPPISPKIKPTIKKVKIDSKNTILHKDSSFMIVEVAGSIAAARRE
QVANRQVQRKQRIAHYGRTNSPKLLSAAVDSTSREAKRCSFITPNSDPMYIAYHDEEWGV
PVHDDNLLFELLVLTVAQVGSDWTSVLKRRQDFRDAFSGFDAEVVAKYNEKKINSTSIEY
GIELSQVRGVVDNSKRILEMKKQFGSFDKYVWGFVSNKPIRTQYKACNKIPVKTSKSETM
SKDMVKKGFRYVGPTIIHSFMQAVGLTNDHIITCPRHAQCATQKPIAM
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgtgttcttacaagttcaagaaacaaggaggagttgttgatatttcatcacaatcaatc
tctcatatcaatggtcgtcctgttcttcaaccctataacaattcccacaaaaaaaataat
tcatgtaatgtcaagatttcaccttctcccaaaatcaagaaagttaatgtgttggataca
aatacaagtaatgagaaaagtatgacacccaaaatcacaaaatcaagtcctcctatttca
cctaaaatcaagccaactatcaagaaagtgaagattgattctaaaaacacaatcttgcac
aaagattcatcttttatgattgttgaagttgctggaagtatagcagcagcaagaagggaa
caagttgccaataggcaagtccagaggaaacagagaattgcacattatggaagaactaat
tcacccaaattactctctgctgctgtggattcaacttctagagaagccaaaagatgcagc
tttatcacacctaattctgaccctatgtatattgcataccatgatgaagaatggggagtt
cctgtccatgatgataatctgttatttgagttgttggtgttaactgtggctcaagttgga
tcagactggacttcagtcttaaagagaaggcaagatttcagggatgcattttcaggattt
gatgcagaagttgttgcaaagtacaatgaaaagaagataaattcaacaagcattgaatat
ggaattgagttgagccaagttagaggggttgttgacaactctaaaagaattttagagatg
aagaaacaatttgggtcattcgacaagtacgtatggggatttgtgagcaacaagcccatt
agaacacaatacaaggcttgcaacaaaataccagtaaagacatcaaaatcagaaacaatg
agcaaagatatggtgaaaaaagggtttagatatgttggcccaacaattatacactctttt
atgcaggcagttgggcttaccaatgaccacattatcacttgtccaagacatgcccaatgt
gctactcaaaaaccaattgctatgtga

KEGG   Solanum pennellii: 107005300
Entry
107005300         CDS       T04130                                 

Definition
(RefSeq) uncharacterized protein LOC107005300 isoform X1
  KO
K01246  DNA-3-methyladenine glycosylase I [EC:3.2.2.20]
Organism
spen  Solanum pennellii
Pathway
spen03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    107005300
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spen03400]
    107005300
Enzymes [BR:spen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.20  DNA-3-methyladenine glycosylase I
     107005300
DNA repair and recombination proteins [BR:spen03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     107005300
SSDB
Motif
Pfam: Adenine_glyco
Other DBs
NCBI-GeneID: 107005300
NCBI-ProteinID: XP_015059340
LinkDB
Position
12
AA seq 372 aa
MSGASRVRSMNVADSEARPVLGLAGNKAQRSPGSRKSISKPTRKIVKSKEELEMEDKNGH
QPSPSLLPFDVPSILRRQESLYSNFSLSASCSSDASTDSYHSSASTGRIYKMNSTSSRRK
QLASKSKRIVSDDISDSSIDGSQPKKRCAWVTPNTDPSYANFHDEEWGVPVHDDKKLFEL
LVLCGALAELTWPSILCKRHIFREVFADFDPIVVAKLNEKKTLAPGGTACSLLSELKLRG
IIENARQMLKVIDEFGSFDKYIWSFVNHKPIVSGFRYPRQVPVKTAKADLISKDLIRRGF
RGVGPTVVYSFMQVAGITNDHLISCFRFPDCVESTEGKEKDSNNDETESTQANKANETEI
CRSIDDLSFSSE
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgtcaggagcttcaagagtaaggtcaatgaatgtagctgattcagaagcaaggccagtt
cttggactagctgggaataaggcacagagatcacctggttcaagaaaatctatttcgaaa
cctacgagaaagatagtgaagtcaaaagaggagcttgagatggaagataaaaatggtcac
cagccatccccttcattgcttccttttgatgttccttcgatacttaggcgacaagagtca
ttgtattccaacttttcacttagtgcttcatgttcttctgatgcctcgacggattcatat
cacagcagtgcttcaactggtaggatatataaaatgaatagtacctcaagcagaagaaag
cagttggcgtcgaagtccaaaaggatagtttcagatgatatatcagactcttcaattgat
ggttcacaacccaagaaaagatgtgcctgggtgacacctaatacagatccatcttatgct
aatttccacgatgaagaatggggagttccagtccatgacgacaagaagctattcgagctc
cttgtcctttgcggggcattggctgaactcacatggccttccattctttgcaagaggcac
atattcagagaagtattcgcagattttgatcccatagtagtggccaagttgaatgaaaag
aagactttagctcctggaggtacagcatgctcactattatcagaacttaaactgcgaggc
atcattgaaaatgctcgtcaaatgttgaaggttatagatgaatttggatcatttgacaag
tatatctggagctttgtgaaccacaagcctatagtaagtggatttagatatcctcgtcaa
gttccggtgaagacagcaaaagcagatctgattagcaaagacctaattaggagaggtttc
cggggcgtgggacctactgtggtctactctttcatgcaggttgctggtattacaaatgac
catcttattagttgctttagatttcctgactgtgttgaatctactgaaggtaaagagaag
gactcgaacaacgatgaaactgaatcaacacaagccaacaaagcaaacgaaacagagata
tgtagatcaatcgatgacttgagtttctcctcagagtga

KEGG   Solanum pennellii: 107011440
Entry
107011440         CDS       T04130                                 

Definition
(RefSeq) uncharacterized protein LOC107011440
  KO
K01246  DNA-3-methyladenine glycosylase I [EC:3.2.2.20]
Organism
spen  Solanum pennellii
Pathway
spen03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    107011440
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spen03400]
    107011440
Enzymes [BR:spen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.20  DNA-3-methyladenine glycosylase I
     107011440
DNA repair and recombination proteins [BR:spen03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     107011440
SSDB
Motif
Pfam: Adenine_glyco
Other DBs
NCBI-GeneID: 107011440
NCBI-ProteinID: XP_015066435
LinkDB
Position
2
AA seq 395 aa
MCNSKTKLQSSAQTLSQINGRPVLQPHSNIVPLYERRNSLKKTTHTAAPVTANGSTKVKT
SSSTTPPVSPKMKSPRLPAIKRGNNIDPNGLSSSAEKIVTPKGTANKAPILLKKPKKSSG
GLASPSSVENSSLKYSSSLIVEAPGSIAAARREQVAIAQVQRKMKIAHYGRTKSAKYEGK
VSSLDPSFASAVIPNPREDKRCSFITPNSDPLYIAYHDEEWGVPVHDDNLLFELLVLTGA
QVGSDWTSVLKKRQEFRDAFSGFDPEIVSKYNEKKITSTSVEYGIELSQIRGAVDNSTRI
LEIKKTFGSFDKYLWGFVNNKPIATQYKACNKIPVKTSKSETISKDMVKRGFRYVGPTVI
HSFMQAAGLTNDHLIACPRHLQCVALATQPAPPAL
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgtgtaattccaaaactaaactgcagagcagcgcacaaactctctcacaaattaatggc
cgccctgttcttcaaccacatagcaatatagttcctctttacgaacgccgcaactcgctt
aaaaagacaacacacactgctgcacctgttactgcaaatggaagtactaaagtcaagacg
agttcatcaacaactccaccggtctcacctaaaatgaagtcgccaagactaccagctatt
aagagagggaataacattgatcctaatggcttgagttcaagtgctgagaaaattgtgaca
cccaaagggactgctaataaagccccaattctgttaaagaagcctaagaaaagcagcggg
ggcttagcctcaccctcttctgtggagaattcttcgttgaaatattcttcttccttgata
gtcgaggctccgggaagcatagcagcagcaagaagggaacaagtagcaattgcacaagtg
cagaggaaaatgaaaattgcgcattatggaagaacaaaatcagccaagtatgaaggaaaa
gtatcttctcttgacccttccttcgcctcagcagttatccctaatcctagagaggacaaa
agatgcagctttatcacacctaattcagacccactatatattgcataccatgatgaagaa
tggggagttccagtccatgatgataatctgctttttgaattgctggtattaactggtgca
caagttggatcagactggacttcagttttaaagaaaaggcaagaattcagggatgccttt
tcaggatttgatccagaaattgtttcgaagtacaatgaaaagaagataacttcaacaagt
gtcgaatatggtatagagcttagccaaatccgaggagctgtcgacaactctaccagaatt
ttagagattaagaagacatttggttcgttcgacaagtatctgtggggattcgtgaacaac
aagcccattgcaacacaatacaaggcatgcaacaaaatcccagtgaagacttcaaaatca
gaaaccataagtaaagacatggtcaaaagagggttccgctatgtcggccccaccgttata
cactcgttcatgcaggcagccggactcaccaacgaccacctgatcgcctgtccacgacat
ctccagtgtgtggcattggcaactcaacctgcaccccctgccctataa

KEGG   Solanum pennellii: 107015505
Entry
107015505         CDS       T04130                                 

Definition
(RefSeq) uncharacterized protein LOC107015505
  KO
K01246  DNA-3-methyladenine glycosylase I [EC:3.2.2.20]
Organism
spen  Solanum pennellii
Pathway
spen03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    107015505
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spen03400]
    107015505
Enzymes [BR:spen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.20  DNA-3-methyladenine glycosylase I
     107015505
DNA repair and recombination proteins [BR:spen03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     107015505
SSDB
Motif
Pfam: Adenine_glyco
Other DBs
NCBI-GeneID: 107015505
NCBI-ProteinID: XP_015071289
LinkDB
Position
3
AA seq 395 aa
MSGGPRVKLMNNADSEVRSVLGPAGNKARSVELRKPVEKPVKKAAESEESKGKKFEGTDS
VPQSRAKKCGGAVPSILRQQQDHRSLVMRPNLSLNASCSSDASTDSSHSRASTTGKMSRG
SVTPTAGRRKQCSSPKVVKSEKIGKTVGEGESLASSPTPDDASVMKKRCAWVTPNTDPSY
AAFHDEEWGVSVHDDKKLFELLSLCTALAELSWPAILSKRHMFREVFQNFDPVAVSKLNE
KKIAPPGSPASTLLSEVKLRAVIENARQTCKIIDELGSFDKYIWGFVNNKPIVSQFRYAR
QVPMKTSKAEGISKDLVKRGFRGVGPTVVYSFMQVAGITNDHLISCFRFHDCVAATDGTD
KDDGLAAKTEVKQLQLKDETEMGLIRAIDDFNLST
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgtctgggggacctagggttaaattgatgaacaatgctgattctgaagtccgatcagtg
ctcggtccggcgggtaacaaggctagatccgttgaattacggaagcccgttgaaaagcct
gttaagaaggctgctgaaagtgaagagtctaagggtaagaaatttgagggaacggattcc
gtgccgcaatcacgggcgaagaaatgtggaggagctgtgccgtctattttgagacagcaa
caggaccataggtcattggtgatgaggcctaatttgtcgctgaatgcatcttgttcgtcg
gatgcttcgacggattcttctcatagccgagcatcgacgacagggaaaatgagccgtggt
agtgtgacgccgacggctggaagaaggaagcaatgtagtagtccgaaagtggtgaagtct
gagaaaattggaaaaactgttggtgaaggtgagagcttggcttcaagtcccactccggat
gatgcttcggtgatgaagaaaaggtgtgcttgggtgaccccaaatactgatccatcctat
gctgcttttcatgacgaggaatggggagtttcagtccacgatgacaagaagctctttgaa
cttctcagtttatgcactgcattagctgaactctcatggccggcaattctcagtaaaaga
catatgtttagagaagtctttcaaaattttgacccagttgcagtctcaaaactaaatgag
aagaagatagcaccaccaggaagtcctgccagcactcttttatcagaggtaaagctacgg
gcagttattgaaaatgcacgccaaacgtgtaagatcatcgatgaacttggatccttcgac
aaatacatatggggttttgtgaataacaaacctatagttagtcaattccgatatgcaagg
caggtgccaatgaagacatcgaaagctgaagggataagtaaagacctagttaaaagagga
ttcagaggagttggacctactgttgtgtactcattcatgcaagtagctggaatcacaaac
gaccatctcatcagttgcttcagatttcatgattgtgtagctgcaaccgatggaacggat
aaagatgatggccttgcagccaagacagaagtgaagcaactacaactcaaggatgaaact
gagatgggtcttataagagctattgatgacttcaatttatcaacatag

KEGG   Solanum pennellii: 107015923
Entry
107015923         CDS       T04130                                 

Definition
(RefSeq) uncharacterized protein LOC107015923
  KO
K01246  DNA-3-methyladenine glycosylase I [EC:3.2.2.20]
Organism
spen  Solanum pennellii
Pathway
spen03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    107015923
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spen03400]
    107015923
Enzymes [BR:spen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.20  DNA-3-methyladenine glycosylase I
     107015923
DNA repair and recombination proteins [BR:spen03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     107015923
SSDB
Motif
Pfam: Adenine_glyco
Other DBs
NCBI-GeneID: 107015923
NCBI-ProteinID: XP_015071853
LinkDB
Position
4
AA seq 339 aa
MSSSPELRSPAKTGGDTRKILGPGGNRVRDSEEQKKKKEGMKKTEFRSKKAAASVTPKKI
LPVRSNVSVDSSSSSDSSIAKDVIFSKRGVERSTGVKKPAKVVPHGVEVEAAEAFSPVVP
IPLKRCDWITPNSEPLYISFHDEEWGNPVYDDTKLYELLALSQVLSEMTWPAILNKRHIF
RKLFDNFDPSCLANVTEKRLRSLRETGNSLLSEPKIRAIVENAKHFQKIQQEFGSFSNYF
WRFVNHKPIRSGFRYARQVPVKTPKSELMSKDLMKRGFVCVGPTVVYSFMQVAGIFNDHL
ITCFRYNECNNDNINKHSQTKLVKTDIQGRDPVENNTYE
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgtcatcgtcaccggagctccggtcaccggcgaaaaccggcggtgatacaaggaaaata
ctcggtccgggagggaacagggttagagattcggaagagcagaagaagaagaaggaagga
atgaagaagactgagttcaggagtaagaaagcagcagcttcagttacgccgaagaaaatt
ttgcctgtgaggagcaatgtgtcagttgatagctcctcttcgtcggattcgtcgattgcg
aaagatgtgattttttcgaagagaggagttgaaaggagtactggtgtgaaaaaacctgct
aaagttgttcctcatggagttgaagttgaagcagctgaagctttttctccggtggttcca
attccgctcaaacgttgtgattggataacaccgaattcggaacccctgtatatttcattc
catgacgaagaatggggaaacccagtttacgatgacacaaagctatatgaacttcttgcc
ttatcccaagtattgtcagaaatgacttggcctgcgatccttaataagagacacatattc
aggaagttgtttgacaattttgatccatcatgtcttgcaaatgttactgagaaaagactg
cgctcgttgagagaaactggaaattcattgctatctgaaccaaagattcgtgcaatagta
gaaaatgcaaagcatttccagaagatacagcaggagtttggatcctttagcaactacttc
tggcgttttgtaaatcacaagccaataagaagtggatttcgctatgcacgtcaagtacca
gtaaaaacaccaaaatcagaacttatgagcaaggacctaatgaaaaggggcttcgtttgc
gtaggaccaacagttgtgtattcattcatgcaagtggcaggtatatttaatgaccatctc
attacatgcttcagatacaacgaatgtaacaacgataatatcaacaagcactcacaaaca
aagttagtaaagacagatatacaaggccgggaccctgttgagaacaacacatatgagtaa

KEGG   Solanum pennellii: 107017304
Entry
107017304         CDS       T04130                                 

Definition
(RefSeq) uncharacterized protein LOC107017304
  KO
K01246  DNA-3-methyladenine glycosylase I [EC:3.2.2.20]
Organism
spen  Solanum pennellii
Pathway
spen03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    107017304
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spen03400]
    107017304
Enzymes [BR:spen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.20  DNA-3-methyladenine glycosylase I
     107017304
DNA repair and recombination proteins [BR:spen03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     107017304
SSDB
Motif
Pfam: Adenine_glyco HhH-GPD
Other DBs
NCBI-GeneID: 107017304
NCBI-ProteinID: XP_015073052
LinkDB
Position
4
AA seq 279 aa
MSKPNARRYAIEKHNKEESIISNNYGNNLFYLSKHLKKVYPIELHKTFINDFSSPLDHKK
REILDNNIVVPQVIPCPNEKELMRCSWITNTTDKVYVQFHDECWGVPVYDDHQLFELLSL
AGLLMDFNWTEILKIREQIREAFVGFNAKQVAEMGEKDINELVSNVSLMLAENRVRSIVN
NAKCIVKIGEEFGSLSCYMWNHMNYKAIINRFKNARNVPLRSPKAEAISKDLVKRGLRHV
GPVVINSFMQAAGMTNDHLIYCFRHKQCVNLAERPWRHV
NT seq 840 nt   +upstreamnt  +downstreamnt
atgtctaagccaaatgcaagaagatatgcaatagagaaacacaataaagaggagtctata
attagcaataattatgggaataacttgttttatttatccaaacatttgaaaaaagtttac
ccaatagagcttcacaaaacttttataaatgatttttcttctccattggatcataaaaaa
agagaaattctagacaacaatattgttgttccacaagttattccatgtcctaatgagaaa
gagcttatgaggtgtagctggataactaataccacagataaggtttatgtgcaattccat
gatgaatgctggggtgttccagtttatgatgaccatcaattgtttgagttactttctttg
gctggcttgttgatggatttcaactggactgaaattttaaagataagggaacaaataaga
gaagcctttgttggattcaatgcaaagcaagtggctgaaatgggagagaaagatattaat
gaattggtgtccaatgtgtccctcatgttggctgaaaatagagttagatcaatagttaac
aacgccaaatgcatagtcaagattggggaggaatttggatctttgagttgctacatgtgg
aaccatatgaattataaagcaataattaacagatttaaaaatgcaagaaatgtaccatta
agaagtccaaaagcagaagcaattagcaaagatttagtgaagaggggattaagacatgtt
ggtccagttgttattaattcattcatgcaagctgctggaatgactaatgatcatttgatt
tattgttttagacataaacaatgtgttaatcttgctgaaagaccttggaggcatgtttaa

DBGET integrated database retrieval system