KEGG   Solanum pennellii: 107002797
Entry
107002797         CDS       T04130                                 

Definition
(RefSeq) DNA polymerase delta catalytic subunit
  KO
K02327  DNA polymerase delta subunit 1 [EC:2.7.7.7]
Organism
spen  Solanum pennellii
Pathway
spen03030  DNA replication
spen03410  Base excision repair
spen03420  Nucleotide excision repair
spen03430  Mismatch repair
spen03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107002797
   03410 Base excision repair
    107002797
   03420 Nucleotide excision repair
    107002797
   03430 Mismatch repair
    107002797
   03440 Homologous recombination
    107002797
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spen03032]
    107002797
   03400 DNA repair and recombination proteins [BR:spen03400]
    107002797
Enzymes [BR:spen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     107002797
DNA replication proteins [BR:spen03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    107002797
DNA repair and recombination proteins [BR:spen03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      107002797
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     107002797
SSDB
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 zf-C4pol DNA_pol_B_2
Other DBs
NCBI-GeneID: 107002797
NCBI-ProteinID: XP_015056450
LinkDB
Position
10
AA seq 1086 aa
MNSGNSKKRSAAATPSPQQQQKHHAAMEEEDLDEDVFLEETLLQYEEDSQVLRELEESNS
IKERLQKWKRPSLSQAYIAQTQSISFQQLEIDYIIAESHKELLPNFSGQAAILRIFGVTK
EGNSVCCHVHGFEPYFYISCPPGMGPDDISRFHQILEGRMREANRNSNAPKFVRRIEVVQ
KRSIMYYQQQASQPFLKIVVALPTMVTSCRGILDRGIQIDGLGMKSFLTYESNVLFALRF
MIDCNIVGGNWIEVPVGKYKKAARNLSYCQLEFDCLYSDLISHSPEGEFSKMAPFRILSF
DIECAGRKGHFPEPTQDPVIQVANLVTLQGQDQPLIRNVMTLKSCSPIVGVDIMSFDTEK
EVLRAWRDLIREVDPDIIIGYNICNFDLPYLIRRAEVLGMAEFPVLGRIRNSRVRVKDAT
FSSRQHGTRESKEITIEGRVQFDLFQAVQRDYKLSSYSLNSVSAHFLNEQKEDVHHSIIS
DLQNGNAETRRRLAVYCLKDAYLPQRLLDKLMFIYNYVEMARVTGVPISFLLSRGQSIKV
LSQLLRKAKQKDLVIPNAKQAGSEQGTFEGATVLEAQAGFYEKPIATLDFASLYPSIMMA
YNLCYCTLVTPEEVRKLNLPPECVNKTPSGETFVKSTLQKGILPEILEELLTARKRAKAD
LKEATDPRVKAVLDGRQLALKISANSVYGFTGATVGQLPCLEISSSVTSYGRQMIEHTKK
LVEDKFTVLGGYEHNAEVIYGDTDSVMVQFGVPTVEEAMKLGREAADYISGTFIKPIKLE
FEKIYYPYLLISKKRYAGLLWTNPDKHDKMDAKGIETVRRDNCLLVKNLVTECLYKILVD
RDVPGAVQYVKNTISDLLLNRMDLSLLVITKGLTKTGDDYEVKAAHVELAERMRKRDAAT
APSIGDRVPYVIIKAAKGAKAYEKSEDPIYVLENNIPIDPQYYLENQISKPLLRIFEPIL
KNASKELLHGDHTRSIAVPTPSNSGIMRFAKKQLTCIGCKTPLSGSDRTICKHCKGREAE
LYCRSVANVAELENLFGKLWTQCQECQGSLHQDVLCTSRDCPIFYRRKKAQKDMAEAKTQ
LDRWNF
NT seq 3261 nt   +upstreamnt  +downstreamnt
atgaactccggcaactctaagaagcgatcggcggcagcaacgccgtcgcctcaacagcag
cagaaacaccacgcagccatggaagaagaggacctagacgaggatgtatttctcgaagag
acattgcttcagtacgaagaagattcacaggtccttcgtgagctcgaagagagcaattcc
ataaaggagaggcttcagaagtggaaacgtccttctctatctcaagcttacatcgctcag
acacaaagcatatcgtttcagcagctggaaattgactacattattgcagagagccataaa
gaattgctacctaatttttctggtcaggctgccattttaagaatcttcggggtcacaaag
gaaggaaatagcgtctgttgtcatgtacatggatttgaaccatacttctatatcagctgc
cctcctggaatgggccctgacgatatctcccgttttcaccaaattcttgagggtaggatg
agagaggcaaataggaacagcaatgcccctaagtttgtccgtcgcattgaagtagttcag
aaaagaagcatcatgtattaccaacagcaggcttctcagccttttctcaagattgtagtg
gcattgccaacaatggttaccagttgccgtggtattctcgatagaggtattcaaattgac
gggcttggtatgaagagctttcttacctatgaaagtaatgttctttttgctcttcgcttc
atgattgactgcaatattgttggtggcaactggattgaagttccagttgggaaatacaag
aaagctgcaagaaatctctcctattgtcaattagagtttgattgtctctattctgacttg
ataagccattctcctgaaggagaattttcgaagatggctccatttcgcatattgagtttc
gatattgaatgtgctggtcgtaaaggccactttccggagcctacacaagatcctgttatt
caagtggccaatctggttaccttgcagggacaggatcagccattaattcggaatgtgatg
acccttaagtcatgctcaccgatagttggggttgatattatgtcctttgacacagaaaaa
gaagtattgcgggcttggagggaccttatccgggaggtggaccctgatataataattgga
tataacatctgcaactttgatttgccatatctcatccggagagctgaagtcttagggatg
gcagaatttcctgtgcttggacgcatcagaaacagcagggttcgtgtaaaggatgcaacc
ttttcttcaagacagcatgggacaagggaaagtaaagaaataacaatagaagggagagtt
caatttgatttatttcaggctgtgcagagggattataagctaagttcttactcactaaat
tctgtctcagcacattttctgaatgagcagaaagaggatgtccatcattcaattatatca
gatcttcaaaatggcaatgcagaaacgaggcgccggcttgctgtatattgtctaaaggat
gcttatctcccacaacggcttttggacaaattaatgttcatttataactatgtggagatg
gctcgagtcactggtgtacctatatcttttcttctatcaagagggcaaagcattaaggtg
ctttctcaacttttaaggaaggcgaagcaaaaggatcttgtcataccaaatgcaaaacag
gctggatctgaacaaggaacgtttgagggggctacggttttggaggcacaggctggtttc
tatgagaagccaattgcaacattggattttgcatctctatatccatcaatcatgatggca
tataatttatgttactgcacgctagtaactcctgaagaggttcgcaaactgaaccttcct
ccagagtgtgtcaacaagaccccttctggtgaaacgtttgtcaagtcaaccttacagaag
ggaatacttccggaaattcttgaagaactattgactgctcgtaaaagagcaaaagcagat
ttaaaggaagctacagaccctcgagtcaaagctgtcttagatggccgtcagctagctttg
aagatcagtgcaaattcagtatatgggtttactggagctactgttggtcaattaccatgt
ttagaaatatcttcaagtgttactagctatggtcgacagatgattgagcatacaaaaaag
cttgtggaagacaagtttacagtacttgggggctatgaacacaacgctgaggttatatat
ggagatacagattccgtgatggtgcagtttggtgtgcctacagtggaagaggctatgaaa
ttgggcagagaagctgctgattacattagcgggacatttatcaaaccaataaaactagaa
tttgagaagatttattacccatatttgctgattagcaagaagagatatgctggtcttctc
tggacaaatccggacaaacatgacaaaatggatgctaaagggattgaaactgttcggagg
gataattgtctcttagtcaagaaccttgtaaccgagtgtctttataaaatactagtagac
agagatgttcctggtgctgttcagtacgtcaagaatactatctcagatcttcttctgaac
cgcatggatctgtctcttttagttattactaagggtctgacaaaaactggagatgattat
gaagtaaaagcagcacatgttgaacttgcagagcgaatgcgcaagcgagatgctgctaca
gcacctagcattggtgatagagtaccttacgtaatcattaaagctgcaaaaggggccaag
gcatatgaaaagtcagaagaccctatatacgtgttagagaacaacatacctatagatcct
caatactatcttgaaaatcaaattagtaagccacttctgaggatttttgagccaatactg
aagaatgcaagtaaagagcttcttcatggagatcacacaagatccatcgcagttccgacc
ccttcaaacagtggtattatgagatttgccaagaagcaactcacttgcattggatgcaaa
acaccactcagtggctctgatcgaacaatctgcaagcactgcaaaggaagagaggccgaa
ctttattgcagatccgtggctaatgtggctgaactagagaatctatttgggaagctatgg
acacaatgccaagaatgccaaggctctctccatcaggatgtcctatgcactagtcgagac
tgcccaatcttttatcggaggaagaaggctcagaaagacatggctgaagctaaaactcaa
ttagatcggtggaacttttaa

KEGG   Solanum pennellii: 107015118
Entry
107015118         CDS       T04130                                 

Definition
(RefSeq) DNA polymerase delta small subunit
  KO
K02328  DNA polymerase delta subunit 2
Organism
spen  Solanum pennellii
Pathway
spen03030  DNA replication
spen03410  Base excision repair
spen03420  Nucleotide excision repair
spen03430  Mismatch repair
spen03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107015118
   03410 Base excision repair
    107015118
   03420 Nucleotide excision repair
    107015118
   03430 Mismatch repair
    107015118
   03440 Homologous recombination
    107015118
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spen03032]
    107015118
   03400 DNA repair and recombination proteins [BR:spen03400]
    107015118
DNA replication proteins [BR:spen03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    107015118
DNA repair and recombination proteins [BR:spen03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      107015118
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     107015118
SSDB
Motif
Pfam: DNA_pol_E_B DNA_pol_D_N
Other DBs
NCBI-GeneID: 107015118
NCBI-ProteinID: XP_015070781
LinkDB
Position
3
AA seq 442 aa
MVSMGVDSEKNFLHRKQSLYQSLDESFGIQKEVYRGQQYSQIYFARLHLMRTLLYSIIPN
WKPHLPVCTVLGLEEGKECIIVGTLYKHMKLKPSILDEYSKERSASPLVQRHNFMHLDDN
LVLEDESGRVKLSGCLLPSTYVTGNIIALHGKETSAGEFLVEDALEAGLPQQIERPIQLG
EDKYVVFISGLSVGRSSSNPLQFQLLVDHITGHLGDEKEQNIAAQIVQVVIAGNFVEVPH
GLLNGQNLGSKDQSRLFEPIKELDILLTQIAASIPLDIMPGSSDPANFSLPQQPLHRCLF
PGSSAYNTFRSCTNPHCFELDNIRFLGTSGQNIDDLGKYSEANNNIDFMERTLRWRHLAP
TAPNTLGCYPFTDRDPFYIETCPHVYFVGNQDKYESRLIKGSEGQMVMLICIPRFAETGV
AVVLNIRNLECHMLSFATQIHS
NT seq 1329 nt   +upstreamnt  +downstreamnt
atggtatcaatgggagttgattcagagaagaactttctccaccgaaaacaatcactttac
caatctttggacgagagttttgggattcagaaggaggtttacaggggtcaacaatacagc
caaatatattttgctaggctccatttgatgcgaactctcctttactctatcattcccaat
tggaaaccccatttacctgtctgtactgttttaggattagaggaaggcaaagaatgcatt
atagttgggacactctacaagcacatgaagcttaaaccttctattctggatgagtactct
aaggagagatctgcttcaccgcttgtacaacgtcataactttatgcacctagatgataat
ttagttctggaagatgagagcggaagagtcaaactaagtggttgtttgctgccgtctaca
tatgtaacaggaaatattattgcattgcatggaaaagaaactagtgctggtgaatttttg
gttgaagatgctctagaggctggcctaccacaacagatagagcggccaattcaactaggt
gaagataaatatgtggttttcatctctggtttgagtgttggaagaagctcttctaatcct
ctccaatttcaacttttagttgatcacattactggacatttaggagatgagaaggaacaa
aatattgcagctcaaatagttcaagttgttattgctggaaactttgttgaagttcctcat
ggacttctcaacggacagaatttggggtcaaaggaccagtccagattgtttgagccaatt
aaagagcttgatattttgttaactcagattgcagcaagtatacctttggatatcatgcca
gggtccagtgatccagcaaatttctccctcccacagcagcctctccatagatgccttttc
cctggatcatcagcgtataacactttcagatcttgcacgaatccacattgttttgaactt
gacaacatcaggttcctaggtacatctggtcaaaatattgatgatcttggcaagtattcg
gaggcaaacaacaatattgactttatggagagaacattgaggtggagacacctagcacca
acagcaccaaataccctcggttgctatcccttcactgatagggatcctttctatatcgaa
acatgtcctcatgtttattttgttggcaaccaggataaatatgaatctcgcttgataaaa
ggatcagaaggacagatggtaatgcttatttgcattcctagatttgcagagactggagtt
gcagtggtgttgaatatcagaaaccttgagtgccatatgctcagctttgccactcaaatc
cactcataa

KEGG   Solanum pennellii: 107019852
Entry
107019852         CDS       T04130                                 

Definition
(RefSeq) DNA polymerase delta subunit 4-like
  KO
K03505  DNA polymerase delta subunit 4
Organism
spen  Solanum pennellii
Pathway
spen03030  DNA replication
spen03410  Base excision repair
spen03420  Nucleotide excision repair
spen03430  Mismatch repair
spen03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107019852
   03410 Base excision repair
    107019852
   03420 Nucleotide excision repair
    107019852
   03430 Mismatch repair
    107019852
   03440 Homologous recombination
    107019852
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spen03032]
    107019852
   03400 DNA repair and recombination proteins [BR:spen03400]
    107019852
DNA replication proteins [BR:spen03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    107019852
DNA repair and recombination proteins [BR:spen03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      107019852
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     107019852
SSDB
Motif
Pfam: DNA_pol_delta_4
Other DBs
NCBI-GeneID: 107019852
NCBI-ProteinID: XP_015075703
LinkDB
Position
5
AA seq 130 aa
MASKSDMKGFYKQTKKNGGITKPTHSKSSLLATTTNKSVTPKLAPARGSNITRSPALISH
GSPDLQADEYDENEELLRQFDTNMTYGPCLGLSRLDRWERAKSFGLNPPTDVEPILRSKV
RNECLWDGMV
NT seq 393 nt   +upstreamnt  +downstreamnt
atggcgtcgaaatcagatatgaagggattctacaagcaaacgaagaaaaatggcggaatc
acaaagccaacacattcaaaatcatcattgcttgctactactacaaacaaatcggtaact
ccaaagctagcacctgctcgcggctcgaacattacccggtctccggcgctcatctctcat
ggatctcctgatctgcaagctgatgaatatgacgagaacgaggagttattaaggcaattt
gatacgaatatgacttatggaccatgtcttggattgagcagacttgacagatgggagcgt
gctaagagttttggtttaaaccctcctacagatgttgagcccatcttgagatctaaggtt
cgtaacgaatgcctgtgggatggaatggtttaa

KEGG   Solanum pennellii: 107029494
Entry
107029494         CDS       T04130                                 

Definition
(RefSeq) uncharacterized protein LOC107029494
  KO
K03505  DNA polymerase delta subunit 4
Organism
spen  Solanum pennellii
Pathway
spen03030  DNA replication
spen03410  Base excision repair
spen03420  Nucleotide excision repair
spen03430  Mismatch repair
spen03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107029494
   03410 Base excision repair
    107029494
   03420 Nucleotide excision repair
    107029494
   03430 Mismatch repair
    107029494
   03440 Homologous recombination
    107029494
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spen03032]
    107029494
   03400 DNA repair and recombination proteins [BR:spen03400]
    107029494
DNA replication proteins [BR:spen03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    107029494
DNA repair and recombination proteins [BR:spen03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      107029494
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     107029494
SSDB
Motif
Pfam: DNA_pol_delta_4
Other DBs
NCBI-GeneID: 107029494
NCBI-ProteinID: XP_015086409
LinkDB
Position
9
AA seq 120 aa
MASKSSMKGFFKQQKKSGGITKPSKSKSTKPKNAAAIGSNVTQPSALISHGSLDLKDNYD
QNEEVLRQFDMNMVYGPCLGMNRLDRWERAKKLGMNPPADVERLLRSNKVRNECLWDGRV
NT seq 363 nt   +upstreamnt  +downstreamnt
atggcgtcgaaatcgagcatgaaaggtttcttcaagcagcagaagaagagtggaggcatc
acaaaaccatcgaaatcaaaatccaccaaaccaaaaaatgctgcagctattggttctaat
gttactcagccttcagcactcatctcccatggctctcttgatttgaaagataattatgat
cagaatgaggaagtgttgaggcaattcgacatgaatatggtttatgggccatgccttgga
atgaacagactggacaggtgggagcgtgccaagaaacttggaatgaaccctccagcagac
gtggagcgccttttaaggtctaacaaagttcgcaatgagtgcctgtgggatggtcgcgtt
tag

KEGG   Solanum pennellii: 107032134
Entry
107032134         CDS       T04130                                 

Definition
(RefSeq) nucleolar protein dao-5
  KO
K03504  DNA polymerase delta subunit 3
Organism
spen  Solanum pennellii
Pathway
spen03030  DNA replication
spen03410  Base excision repair
spen03420  Nucleotide excision repair
spen03430  Mismatch repair
spen03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107032134
   03410 Base excision repair
    107032134
   03420 Nucleotide excision repair
    107032134
   03430 Mismatch repair
    107032134
   03440 Homologous recombination
    107032134
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:spen01009]
    107032134
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spen03032]
    107032134
   03400 DNA repair and recombination proteins [BR:spen03400]
    107032134
Protein phosphatases and associated proteins [BR:spen01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107032134
DNA replication proteins [BR:spen03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    107032134
DNA repair and recombination proteins [BR:spen03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      107032134
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     107032134
SSDB
Motif
Pfam: CDC27 MsyB
Other DBs
NCBI-GeneID: 107032134
NCBI-ProteinID: XP_015089198
LinkDB
Position
10
AA seq 543 aa
MADIETLGIVDEIQALVSDKLQVVSYKWLSRNFLVSSNSAKRLLQEFVEKHGNGVEVVYS
LSGWLKDSPSTYHIRLVTSANLAEAKKEFSDDCSVQVYSVQACIPKDPVALWNSEFVQAE
ELFRQSLSADNCLLDNRFCGVSNPFITRNGGGTIPSTNAVPQVKSEASGLRNSNSTAQVK
PEQKKVQLPSPSASVPSSHVVDAKSESRGASGPGEGSKFVADKHKVAQLPPAKKAVQSEK
SSKNGGALANMWGRIPTKPKVDIVSAASSDATPNPVGNAAQICTPEGIEDRISDDDDQQV
SIRRTSNGEGNRKRRVIFDFSDEEDEFKDAVNLASPEPPKQKSILGSKQTPSTPELEKRE
VKKAKDSKSHEQETMEAGSKSPEQETFSKKSPEQETFSKRSHEQERKPLPTSECKSSKLH
SSEIIPEHASPKNAAVKDEVTNAAPTSPKRRKVMKTRIDERGREVTEVVWEGEDTETKAD
SNTMKKADNNPVNSTGDRAPMAKKSPALGSTAPTNQANKAGNKKAGNKDPKQGNILSFFK
KKA
NT seq 1632 nt   +upstreamnt  +downstreamnt
atggcggatatcgaaaccctaggcatcgtcgatgagattcaagctcttgtatcagacaaa
cttcaagtggtttcgtacaagtggctgagtcgaaattttttggtgtcatcaaattctgca
aagaggttgcttcaggaatttgttgaaaagcatggaaatggtgttgaagtggtctacagc
ttgtctggctggttgaaagatagcccttcaacctaccatataagacttgtcacttctgct
aacctcgcagaagccaagaaagaattttcagatgattgctcagtccaggtctatagcgtg
caagcttgcatcccaaaggatccagtggccctctggaattctgaatttgtccaggccgaa
gagctatttaggcagtccctctcagctgataattgtttgctcgataataggttttgtgga
gtttcaaatcctttcatcacgcgcaacggtggaggaacaattccaagcactaatgctgtt
cctcaggtgaaaagtgaagcatcaggacttcgtaatagtaactctactgctcaagtgaaa
cctgagcagaaaaaggttcaactaccaagtcctagtgccagtgtaccatcttcacatgtg
gttgatgccaaaagtgagagtcgtggcgcatcaggtcctggagagggtagtaagtttgtc
gcagataaacacaaagttgctcaacttccacctgctaagaaggcagttcagtctgagaaa
agttctaaaaatggtggggcattggctaatatgtggggtcgcatacctacaaagccaaaa
gttgatattgtttctgctgctagcagtgatgccacaccaaatcctgttggtaatgcggct
cagatatgtactccagaaggaatagaagataggatcagtgatgacgatgatcaacaagtc
agcatcaggaggacatcaaatggtgaggggaatagaaaaaggagggtaatttttgatttt
tcagatgaagaagatgaattcaaggacgctgtcaacctagcctcacctgaacctccaaag
cagaaatctattttaggatcaaaacaaactcctagtactccagaactggaaaagcgggaa
gtcaagaaagcaaaggacagcaagagtcatgagcaagaaacaatggaggctggcagcaag
agtcctgagcaagaaacattctcgaaaaagagtcccgagcaagaaacattctcaaaaagg
agtcatgagcaagaaagaaaacctttacctaccagcgaatgtaagtcttctaagttgcat
tcttctgagattattccagaacatgccagtcctaagaatgccgctgtaaaggatgaagtc
accaatgctgctccaacttctcctaaaagaagaaaagtaatgaagacacgaattgatgaa
cgtggaagagaagtgaccgaggttgtttgggaaggtgaagatacagaaacaaaggctgac
agtaatacaatgaagaaagctgacaacaatccagttaatagtactggtgacagagcacct
atggctaagaagtctcccgctctgggaagtactgcacctacaaatcaagccaataaagca
ggaaacaagaaagcaggaaataaggatcctaaacaaggaaatatcctatcattttttaag
aagaaggcttag

DBGET integrated database retrieval system