KEGG   Solanum pennellii: 107003250
Entry
107003250         CDS       T04130                                 

Definition
(RefSeq) DNA polymerase epsilon subunit 3
  KO
K02326  DNA polymerase epsilon subunit 3 [EC:2.7.7.7]
Organism
spen  Solanum pennellii
Pathway
spen03030  DNA replication
spen03410  Base excision repair
spen03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107003250
   03410 Base excision repair
    107003250
   03420 Nucleotide excision repair
    107003250
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spen03032]
    107003250
   03036 Chromosome and associated proteins [BR:spen03036]
    107003250
   03400 DNA repair and recombination proteins [BR:spen03400]
    107003250
Enzymes [BR:spen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     107003250
DNA replication proteins [BR:spen03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    107003250
Chromosome and associated proteins [BR:spen03036]
 Eukaryotic type
  Chromatin remodeling factors
   CHRAC complex
    107003250
DNA repair and recombination proteins [BR:spen03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      107003250
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone AP3D1 CENP-T_C Bromo_TP DUF2201_N DUF4746
Other DBs
NCBI-GeneID: 107003250
NCBI-ProteinID: XP_015057038
LinkDB
Position
11
AA seq 175 aa
MAEIEKQNKEKEKVVAETTVQIDQEGLPKTIVRRLVKEKLSQLSTDTDISLLRDSLLAFS
ESARIFIHYLSATANDICKESKRQTINAEDVFKALEEIEFPELIEPLKASLEGFREKNSK
RKSTSSKSPESNKKAKLKEPVENGKGKMKEQPLDNENEDAQAEEEVNEVDDSVDD
NT seq 528 nt   +upstreamnt  +downstreamnt
atggcggagatagagaagcagaacaaggagaaggagaaagtagtagcagaaacaacagtg
caaatcgatcaagagggtcttcccaagactatcgtacgtaggcttgtgaaggaaaagctt
tctcagctatctacagatactgatatctcacttcttcgtgactcgcttcttgctttctct
gaaagtgctcgaattttcatccattacctctccgcaacagctaatgacatatgcaaggag
tctaagaggcaaacgataaatgcagaagatgtgttcaaggcccttgaagagattgagttt
cccgagctcattgagcctctcaaagcttctcttgagggattcagagagaagaactctaaa
aggaagtcaacgtcatctaagtccccagaatctaacaaaaaggccaagctgaaagagcct
gtggaaaatgggaagggtaagatgaaagaacaacccttggataacgaaaacgaagatgca
caagctgaagaggaagtcaatgaagttgatgatagtgttgatgattaa

KEGG   Solanum pennellii: 107004841
Entry
107004841         CDS       T04130                                 

Definition
(RefSeq) DNA polymerase epsilon catalytic subunit A-like isoform X1
  KO
K02324  DNA polymerase epsilon subunit 1 [EC:2.7.7.7]
Organism
spen  Solanum pennellii
Pathway
spen03030  DNA replication
spen03410  Base excision repair
spen03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107004841
   03410 Base excision repair
    107004841
   03420 Nucleotide excision repair
    107004841
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spen03032]
    107004841
   03400 DNA repair and recombination proteins [BR:spen03400]
    107004841
Enzymes [BR:spen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     107004841
DNA replication proteins [BR:spen03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    107004841
DNA repair and recombination proteins [BR:spen03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      107004841
SSDB
Motif
Pfam: DUF1744 DNA_pol_B_exo1 DNA_pol_B DNA_pol_B_exo2 RNase_H_2 Lzipper-MIP1
Other DBs
NCBI-GeneID: 107004841
NCBI-ProteinID: XP_015058702
LinkDB
Position
11
AA seq 2218 aa
MNTAESSRRWDRRDSRFSKKQKLTLNSEEQLESKLGFDVFTEGDKRLGWLLTLASSSWED
QETRKVYSCVDLYFVCQDGSTFKAKYKFRPYFYVATKDKMEMDVDSYLRRRYESQIADIE
VLEKEDLDLKNHLSGLHRSYLKISFDTVQQLMDVKRDLTHIVERNQTKFDTIEAYESILT
GKSKQRSQDFIDYITDLREYDVPYHVRFAIDIDVRCGQWYDVSVSSSGVVLEKRTDLLQR
AEVHVCAFDIETTKLPLKFPDAEYDSIMMISYMVDGQGYLIINREYVGEDIEDIEYTPKP
EYEGHFKVTNVKNEEGLLRHWFAHMQVAKPGIYVTYNGDFFDWPFVETRATHYGLSLKDE
LGFSFDKNQGECRAKYACHLDCFAWVKRDSYLPQGSQGLKAVTKAKLGYDPLEVNPEDMV
RFAKEKPQMMASYSVSDAVSTYYLYMTYVHPFIFSLATIIPMPPDEVLRKGSGTLCEMLL
MVQAYKANVICPNKHQSDPEKFYGSQLLDSETYIGGHVECLESGVFRSDIPTSFKLDPSA
YELLISNLDRDLQYSIVVEGKMDLQSVTNYDEVKNAIMEKLMSLRDDPLREECPLIYHLD
VAAMYPNIILTNRLQPPSIVSDEICTACDFNRPGKKCLRKLEWVWRGEIYMAKRSDYYHI
KRQLESELVEVGDGQRSKSFLDLPKAEQQVKLKDRLKKYCQKAYKRVLEKPVTEVREAGI
CMRENPFYVDTVRSFRDRRYEYKGLNKVWKGKLSEAKASGNSIKIQEAQDMVVVYDSLQL
AHKCILNSFYGYVMRKGARWYSMEMAGVVTYTGAKIIQNARLLVEKIGKPLELDTDGIWC
ALPGSFPENYTFKTKDPKKKLTISYPCVMLNVDVARNNTNDQYQTLKDPINKTYTIHSEC
SIEFEVDGPYKAMILPASKEEGILIKKRYAVFNDDGTLAELKGFEIKRRGELKLIKVFQA
ELFDKFLHGSTLEECYSAVAAVADRWLDLLDNQGQDIADSELLGYISESSTMSKSLADYG
EQKSCAVTTAKRLADFLGDAMVKEKGLLCQYIVACEPKGTPVSERAIPVAIFETNAEIMR
YYVKKWCKISSEIGIRSIIDWSYYKQRLSSAIQKIITIPAAMQKVSNPVPRVVHPDWLHK
KVREKEDKFRQRKLNDIFSSVNKDDTMASKHSKNQQNFEDLEDFRLSGKSSIFGPRPVVH
RHGVNKEHLVNTSDRLDSQQQNGQASSPSKMLPSQEIADVEDIDRNVDYHGWLQQKKRKW
KEIREERKRQRLDTSSTVNHVNGSTDMFHSMANRKCQGKTGVNSYFERHELAFTRNHWQI
VQLEPTSQHGQFFAWVVVEGVMHKISVTIPRVFYLNSKAPITEEFPGRRVNKILPHGRHS
YNLIEVTIDEDQFKSESKKLAAHLADPEVEGIYEAKVPLEFSAILQMGCVCKVDKATKKR
NPQDGWSLSELHMRTTTECPYLEQSIAFFYLYHSVSDVRAIFVGHFPASKMIHVVVVNPF
QNKELSQNVLERHFHEACRTFSGQPITQKEGISFKLDYVGYIKDAERILQRAVNEHRHHG
PAVAMIECPNAHLLKSGIRALEDFPCISIPCNARDSQYQALGWQNVAAKIGMQRCATSSQ
WLNERISLSRYAHVPIGNFDVDWLMHTADIFFSRALRDQQQVLWISDNGIPDLGGINDEV
SSFMDEVNQPVLTYPGAYRKVTVELKIHHLAVDALLKSNQVNEMEGGTLFGLDQDLNPTA
NFTNEQYFFDATTSCAPAFRVLKQLIQRCLTDAVTSGNIFADAMLQHLYRWLCSPRSRLH
DPALHSMLHKVMQKMFALLVAELRKLGAAIVFADFSKIIIDTGKSDIFAAKAYCDNVIKN
VQSRELFEWIELEPLQFWHSLLFMDQYNYGGIQARHSDEPLEVNSEPGEESVCGESQVDI
VSSWNIAENLPKATQDHFILIVSEFMYGPWKYAQEQATHRASTSDGDLCTPSITAAHAET
FDLQMAEDLKKKIGTYFTDKLLKIVCDPNLQMKAMDNSQKIQETPDANSQSISHVQKGDP
ALEFIKHVCAVLALDQNVQHEVLIMRKNLLKLVRVREFAPEAEFRSLSVSYTLPNVICSY
CNDCRDLDLCRDRALISQEWRCAVPQCGQPYDRETMENALVQIVRQRERLYHLQDLVCLK
CHQVKAAHLSDHCACAGSFICKEDVSDFRNKMQVFLNIAVNQKFQLLEECTSWILEAR
NT seq 6657 nt   +upstreamnt  +downstreamnt
atgaataccgctgaaagtagccggcgctgggaccggcgggactctaggttttcaaagaag
cagaaactcacacttaactccgaagaacagctcgaatccaagctaggattcgatgttttc
actgaaggagataaacgactcggctggcttcttactcttgcctcttcgtcatgggaggat
caggagactcgcaaagtgtacagttgtgtcgatctttattttgtttgtcaggatggttca
acattcaaagcaaagtacaaattcaggccatatttttatgtggcaacaaaggataaaatg
gaaatggatgttgactcatatctgagaaggcgatacgaatctcaaatcgcagatattgaa
gttttagagaaagaggatcttgatcttaaaaaccatctgtctggcctacacagatcatat
ttaaagatatcatttgacactgtccaacagttgatggacgtgaagcgtgatctaacacac
attgttgagagaaatcaaacgaagtttgatacaatagaagcatatgaatctatactgacg
gggaaaagcaagcagcgaagtcaagattttatagattatatcactgatctacgtgaatat
gatgtcccctaccatgttcgctttgccattgacattgatgttcgatgtggtcagtggtat
gatgtgagtgtatctagctccggtgttgtgttggagaagaggactgatctcttgcagcga
gctgaagttcatgtttgcgcctttgatattgaaaccacaaagcttcctcttaaatttcct
gatgccgaatatgattccataatgatgatctcatacatggttgatggccaaggctatctc
attattaacagagagtatgttggggaagatattgaggatatagagtataccccaaaacca
gaatatgaagggcattttaaagtgacaaatgtgaaaaacgaggaagggctccttaggcac
tggttcgcacacatgcaagtggcgaagcctggtatctatgtaacatataacggtgacttc
tttgattggccatttgttgagacaagagctactcattatggcttgagcctcaaggatgag
cttgggttttcctttgacaagaatcaaggggaatgtcgtgctaaatatgcttgccatctg
gactgttttgcttgggtcaaacgtgatagttatcttcctcaaggaagccaaggtctgaag
gctgtaacgaaggccaagttgggttatgaccctctagaagtcaatcctgaggatatggtt
cgctttgcaaaggaaaaaccacagatgatggcttcatattctgtttcagatgctgtttca
acatactacttgtacatgacttatgttcatcccttcattttctcccttgcaaccataata
cccatgccgccagatgaagtcttgcgcaaaggaagtgggactttgtgtgaaatgcttctt
atggttcaggcttataaggcaaatgttatctgtccaaacaagcaccagtctgatccagag
aagttttatggtagtcaactccttgacagtgagacatacattggtggtcatgtggaatgc
ctagaaagtggtgtattcagatctgacatcccaaccagttttaaactcgatccctctgcc
tatgagctattgatcagcaaccttgatagagatctgcagtattctattgtagttgagggg
aagatggacttgcagtctgtcacaaattatgatgaagtgaagaatgccatcatggaaaag
ctaatgagcttacgagatgatcctttaagggaagaatgccccctcatatatcatcttgat
gtagctgccatgtatccaaacatcatacttacaaataggcttcagccaccatcaatagta
tcagatgagatatgcactgcatgcgattttaatcgtcctggcaaaaagtgtctccggaag
cttgaatgggtttggcgtggtgaaatatacatggcaaaaaggagtgattattaccacata
aagagacaactcgaatctgaacttgttgaagtaggagatggtcaacgatcaaagtctttt
cttgatttgcctaaagcagaacaacaagtaaagctcaaggaccgtttaaagaaatactgt
caaaaggcatataaaagagttcttgaaaagccggtcacagaagttcgagaagcagggatc
tgcatgcgagaaaatcctttttatgttgatactgtacggagtttccgagataggaggtat
gaatacaaagggctcaataaagtttggaaaggtaagctgtctgaagcaaaggctagtgga
aattccataaagattcaagaagcacaggacatggtagttgtgtatgattcattgcagctg
gctcataaatgcattttgaactccttttatggttatgtcatgcgcaagggtgcgagatgg
tactcaatggagatggctggagttgtcacatatactggtgcaaaaatcattcagaatgct
cgattgttggttgaaaaaattggaaagcccctcgaattagacacagatggtatttggtgt
gcattaccaggctctttcccggagaattataccttcaagacaaaagatccaaagaagaag
ctgacaatatcttatccttgtgtaatgctgaatgttgatgtggcaagaaacaataccaat
gatcagtaccagacgctcaaggaccccatcaataagacatatacaatacacagtgaatgc
tcaattgagtttgaagtggatggaccatataaggcaatgattcttcccgcttccaaggaa
gaaggtattctaataaagaagcgatatgcagttttcaatgatgatggtacacttgccgaa
cttaaaggttttgaaattaaacgtagaggtgagctaaagctcataaaagtatttcaggct
gagctttttgataagttcctccatggatcaaccttagaggaatgctattcagcagttgct
gctgtggcagatcggtggcttgacctgcttgataatcaaggccaagatattgcagacagt
gagttgcttggatatatatctgaatcaagcacaatgagcaagtccctagccgattatggt
gaacaaaagtcatgtgcagtaactactgctaaacggcttgctgattttctaggggatgcg
atggtcaaagagaaaggattgctttgtcaatatattgttgcatgtgagccaaagggaacc
ccagtaagtgaacgtgctattcctgttgcaatatttgaaactaatgctgagatcatgagg
tactatgtcaaaaagtggtgcaaaatatcatcggaaatcggaatacgctccattattgat
tggtcttattacaagcaacgactcagttcagcaattcaaaagattatcacaattcctgct
gcaatgcagaaggtttcaaaccctgtcccaagggtggttcatcctgattggctgcataag
aaggttcgtgaaaaagaagacaaatttcgccaacgaaaattgaatgatatcttcagttca
gtgaacaaagacgacacaatggccagtaaacattctaaaaatcagcaaaattttgaagac
ctggaagactttagactcagtggtaaatcgtctatatttggtccaaggcccgttgttcat
cgtcatggagtcaacaaagaacatctagtgaacactagtgatcgattggacagtcaacag
caaaatggtcaagctagcagtccatccaagatgttaccatcacaagaaattgctgatgtg
gaagatattgacaggaatgtagattatcatggatggctacaacaaaaaaagagaaaatgg
aaagagattcgtgaagaaaggaaacgccaaaggttggatacgtcgagtacagtaaaccat
gttaatggcagtactgacatgtttcatagcatggcaaatcgcaaatgtcagggtaaaact
ggggttaattcctactttgagcgacacgagttagccttcacacgtaatcactggcagata
gttcagcttgaaccgacttcacaacatggacaattttttgcatgggtagttgtggaagga
gtcatgcacaaaatttcagtaactatccccagagtgttttacctcaactccaaagctcct
ataactgaggaatttcctggaagacgtgtcaacaagattcttcctcatggacgccatagc
tataatttaattgaggtcactattgatgaggatcaattcaagtcagaaagcaaaaagcta
gcagctcaccttgctgacccagaagtggagggaatatatgaagcaaaggttccgttagag
ttcagtgctattcttcagatgggttgtgtttgtaaagttgataaagcaactaagaaaagg
aatccacaagatggttggagtttgagtgagctgcatatgaggacaacaactgagtgcccg
tatttggagcagtcaatagctttcttctacttatatcatagtgtatcggatgtacgagcc
atttttgtgggacattttcctgcgtccaagatgatacatgttgtggttgttaatccattt
caaaacaaggaattatcacaaaacgttctcgaaagacattttcatgaagcttgccgaaca
ttctctgggcagcctatcacacaaaaggaaggtattagtttcaagttggattatgtcggg
tacatcaaggatgctgagaggattctacagagagcagttaatgagcataggcatcatgga
cctgcagttgccatgatcgagtgccctaatgcccatttactgaagtctggcatacgggct
ttggaggattttccttgcatcagtatcccttgtaatgctcgggatagtcaatatcaggca
ctaggttggcaaaatgtagcagcaaagattggaatgcagcgatgcgcgacatcctcccag
tggttaaatgaaaggatctctctctcaagatatgcccatgttcccatagggaattttgat
gttgattggctcatgcatacagcagatatcttcttttccagagcacttcgtgatcagcaa
caggtcttgtggatatctgataatggaatccccgacttaggaggcataaatgatgaagta
tcatcgtttatggatgaggtgaatcaaccagttcttacttatcctggtgcatatagaaaa
gttactgttgagctgaagattcatcatctggctgttgatgctctactgaaaagcaaccaa
gtaaatgaaatggaaggaggcactctgtttggattggaccaggacttgaaccctacggcg
aattttactaatgaacagtacttctttgacgcaacaacatcctgtgcaccagcatttcgt
gtacttaagcagttgattcaaaggtgccttacagatgcagtaacatcaggaaacatattt
gctgatgccatgctgcaacatttgtaccgatggctctgcagcccccgatctagactgcat
gacccagctcttcacagtatgcttcacaaggttatgcaaaagatgtttgcattgcttgtg
gctgaactccgaaaattgggtgctgctattgtgtttgccgacttctcaaaaatcattatt
gacactgggaagtcagatatttttgctgccaaagcctactgtgataatgttattaaaaat
gtacaatcaagagaattgtttgagtggattgaacttgagccgttgcagttttggcactca
ttgcttttcatggatcagtacaattatggcggaattcaagctagacatagtgatgaacct
ttagaagttaactcagaaccaggtgaagaaagtgtttgtggtgaatctcaagttgatatc
gtgtcaagctggaacattgcagaaaatttaccgaaggcaactcaggatcacttcattttg
attgtttcggagtttatgtatggtccatggaaatatgcacaagaacaagctacacatcga
gcatctactagcgatggtgatttatgtacaccatcaatcactgctgcacatgctgaaaca
tttgatttgcaaatggcagaagatctaaagaagaagattggaacttacttcactgacaaa
cttctgaaaattgtttgtgaccctaatcttcaaatgaaagcgatggacaactctcagaag
atccaggagacaccagatgcaaactcacaatctattagccatgtccaaaagggggatcca
gctttagagttcattaagcatgtctgtgcagttttggcccttgaccagaatgtgcagcat
gaagttctgatcatgaggaaaaatttattaaaacttgttcgtgtgagggaattcgctccg
gaggcagaatttcgtagtctttctgtatcatatacccttccaaatgtcatttgcagttac
tgcaatgactgcagagaccttgacttgtgtcgagacagagctttgatttctcaggagtgg
cgttgtgctgtgccccagtgtgggcaaccttatgatcgtgaaacaatggaaaatgctctt
gttcaaattgttcgacagagagagaggctataccaccttcaggatctagtatgcctaaaa
tgtcaccaggttaaagctgcacatttatcagatcactgtgcttgtgccggatcatttatc
tgcaaggaagatgtctcagatttccgcaataaaatgcaagtcttcttgaacattgccgta
aatcaaaagttccaattgctcgaagaatgtacttcttggattttggaagccagataa

KEGG   Solanum pennellii: 107012565
Entry
107012565         CDS       T04130                                 

Definition
(RefSeq) DNA polymerase epsilon subunit B isoform X1
  KO
K02325  DNA polymerase epsilon subunit 2 [EC:2.7.7.7]
Organism
spen  Solanum pennellii
Pathway
spen03030  DNA replication
spen03410  Base excision repair
spen03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107012565
   03410 Base excision repair
    107012565
   03420 Nucleotide excision repair
    107012565
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spen03032]
    107012565
   03400 DNA repair and recombination proteins [BR:spen03400]
    107012565
Enzymes [BR:spen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     107012565
DNA replication proteins [BR:spen03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    107012565
DNA repair and recombination proteins [BR:spen03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      107012565
SSDB
Motif
Pfam: DNA_pol_E_B Dpoe2NT Peptidase_M16
Other DBs
NCBI-GeneID: 107012565
NCBI-ProteinID: XP_015067925
LinkDB
Position
3
AA seq 529 aa
MSGVLRNKVQRKFKMRGYSLKVEALSEVLSFLSHFPSDAFDDALELLLDELHHLSLKSSI
LDREPVHKVVSLLLEADAAVEENPSSSSSSASALRVIDTFIVPKFRYDPVKKFFHEHTGR
LPIHGDASAKATLYKDRFLLLFQRVSRDPRFSTLAFDASSSDYGSCEISPIQSLVGRVGR
RWIMGVISQLEDGHFYLEDLTAAVEVNLSSAKITTGFFLENTIVLAEGEMQLDGVFQVRT
CGFPPLEDREKSMAFFSGLDFFGGGILTKEETLRLAELEKNAVNDMFVILSDVWLDNEET
LGNLETILNGYENVEVVPSLFVFMGNFCSQPFNLSFKSISSLRVQFGKLGQMIASHQRLK
EHSRFLFIPGPDDVGPSTALPRCTLPKYLTEEFQKYVPNAIFSSNPCRIKFYTQDIVLFR
HDMLYRMRRSCLIPPSMEETSDPFEHLVATIIHQSHLCPLPLTVQPIIWNYDHGLHLYPT
PHTIVLGDKSEQKAFRYTGVTCFNPGSFSNDGTFVAYRPCNQEVELSAL
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgagcggagttttaagaaacaaagtacagaggaagttcaagatgagaggttactctctc
aaagttgaagctctctccgaagtcctctctttcctttcccatttcccttccgatgctttc
gacgacgctcttgaactccttcttgatgagcttcaccatctttcattgaagtcctcgatt
ttggatagggaaccggtgcataaagtggtgagccttttattggaagcagatgccgccgtt
gaagagaaccctagctcaagttcttcatctgcttctgcccttagggttattgatactttt
atcgtccctaaatttagatacgatcctgttaagaagttctttcatgagcacacagggagg
cttcccattcatggtgatgcttctgcaaaagccaccttatacaaggatagattcctctta
ttgtttcaaagggtatctcgtgatccacggttttcaactcttgcttttgatgcctcttct
tctgattatggcagctgtgagatatctcccattcaatcacttgttggacgagtagggaga
agatggataatgggagtaatatctcagttggaggatggtcatttctacttggaagacctt
actgcagctgttgaagtaaatttatcgagtgcaaagataactacaggtttctttttagaa
aatacaattgtcttggcagaaggtgaaatgcaattggatggtgttttccaggtcagaaca
tgtggttttcctccattagaggacagagaaaagtccatggcgtttttttccggactagac
ttctttggtggtggtattcttaccaaagaggaaactctaaggcttgcagagctggagaaa
aatgctgtgaatgatatgtttgttatactatctgatgtatggctggacaatgaggagact
ttgggaaatctggagacaatcctcaatggttatgaaaatgtagaggtggttccttcttta
tttgtcttcatgggaaacttctgctctcagccatttaatctttcattcaagtccatctcc
agtctcagagttcagtttggaaagcttgggcaaatgattgcatcgcaccaacgactaaaa
gaacatagtcgatttctttttatccctggtcctgatgatgtaggtccttcaacagcctta
cccagatgtactttgcctaaatacctaactgaagaatttcagaaatatgttcctaacgca
atattctccagtaacccatgcagaatcaagttttatacccaagacattgttctattccgc
catgatatgctttatagaatgcgaagatcgtgtctgatacctccctcaatggaagaaacc
agtgatccatttgagcatcttgttgcgactataatacatcaaagccatctctgccctctc
cccttgacggttcaacccattatctggaattatgatcacggtctacacctatatccaacc
ccgcatacgatagtgttgggggacaaaagtgagcagaaagctttcagatacacaggagtt
acatgttttaatcctggttccttttcaaacgatggcacatttgtggcataccggccgtgc
aatcaagaagtagaattatcagcgttgtaa

DBGET integrated database retrieval system