KEGG   Solanum pennellii: 107004468
Entry
107004468         CDS       T04130                                 

Definition
(RefSeq) poly [ADP-ribose] polymerase 3
  KO
K10798  poly [ADP-ribose] polymerase 2/3/4 [EC:2.4.2.30]
Organism
spen  Solanum pennellii
Pathway
spen03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    107004468
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spen03032]
    107004468
   03036 Chromosome and associated proteins [BR:spen03036]
    107004468
   03400 DNA repair and recombination proteins [BR:spen03400]
    107004468
Enzymes [BR:spen01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     107004468
DNA replication proteins [BR:spen03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     107004468
Chromosome and associated proteins [BR:spen03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    107004468
DNA repair and recombination proteins [BR:spen03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     107004468
SSDB
Motif
Pfam: PARP PARP_reg PADR1 WGR BRCT BRCT_2 PTCB-BRCT
Other DBs
NCBI-GeneID: 107004468
NCBI-ProteinID: XP_015058150
LinkDB
Position
11
AA seq 818 aa
MKVHEKRSHSHASDEEKKVTTRKQKAEAAPKKPKIANEGEGSDKVNGRSNAADVAAEFEK
FCRETREHLSIEQMREILEANARDASIADEAVVPRCQDILFYGPVGDCPVCGGALELSGD
SYHCEGAYSEWSSCVYSTRSPPRREEPINIPESIEKTPVYELIEKHRDPKSRPKREIAAA
DKPFVGMMIALSGRLSRTHQYWKKKIEKNGGKVANSVIGATCLVVSPSERDRGGSSKVAE
AVERGIPVVREAWLTDSIEKKQAETLDAYDIASDIAVEGKGLALDQQDSSVVALETLTAE
LKVFGKRGVHIDSKLQDEGGKILEKDGILYNCALTVCDQGRNLNDFCIMQLIVARENRLY
LYYRKGKIGDSPRADDKLEEWENVNDAIREFAKLFEELTGDQFEPWEREKKIHKKNMKFF
PIDIDDGVEVRCGGLGLRQLGVAASHSKLDPKVANLMKVLCSQEIYRYALVEMGYDSPEI
PIGMVTDLHLRRCEDTLKEFVEKLKSSTPTGNKADAVWGDFTQRWFTLIPTTRPFPFKDY
EELADQGASSYEAIRDINTASRLIGDMSGSTLDDPLFERYMKLNCSLSPLEKEEDDYKMI
VKYLDKTYEPVSIGDVSYGVSVENIFAVEASACPSLDDIKKLPNKVLLWCGTRSSNLLRH
LQMGFLPSTCSLPVPGYMFGRAIVCSDAAAEAARYGFTAVDRPEGFLVLAVASLGEEIQE
FSSPPEDTKSLEEKGIGAKGLGKNKTDESEHFVWKDNINVPCGKLIPSEHKESPLEYNEY
AVYDPHQVSIRFLVEVKFEEKDVEYEAVELETEQQPEE
NT seq 2457 nt   +upstreamnt  +downstreamnt
atgaaggttcatgagaaaaggtctcactctcatgcaagtgatgaagagaagaaagttact
acaagaaagcaaaaggctgaggcggcgccaaagaagccgaaaatcgccaatgaaggcgag
ggtagtgataaggttaatggaagatcgaatgctgcggatgtggcagctgaatttgagaag
ttctgtagagagacaagagaacatctctccatcgaacaaatgcgcgaaattctcgaagcc
aatgcccgggatgcttcaatagctgatgaggctgttgttcctagatgccaagacatacta
ttctatggtcctgtcggcgattgtccagtttgtggtggcgcgttagagttgtctggcgac
agctatcattgcgagggagcatatagtgagtggtccagttgtgtctacagcactaggtct
ccaccaagaagagaagagcctataaatatccccgaatctattgaaaaaactcccgtctac
gagctaattgagaaacatagagacccgaaaagtcgtcccaagcgagaaatagctgcagcg
gataaaccatttgtaggaatgatgattgctctttcaggccgtctttctcgaacacatcaa
tattggaagaaaaagatcgagaaaaatggagggaaagtggctaattctgttattggggca
acatgccttgtggtttctccctcggagcgagatcgcggtggctcgtctaaagtagctgaa
gcagtggagaggggtatcccggtagtgagggaggcttggctgaccgatagcatcgagaaa
aaacaagctgaaacgttagatgcatacgatattgccagtgacattgcggtagaggggaaa
ggtcttgcactagatcagcaagattccagtgtggtggcacttgaaaccttaacagctgag
ctaaaagtgtttggaaagagaggtgtgcatatcgacagtaagctgcaggatgaaggtgga
aaaattttagagaaagatggcatattgtacaattgtgctctcactgtttgtgatcaaggg
aggaacctgaacgacttctgcattatgcaacttatcgtggcgcgagagaatcggttgtac
ctttattacaggaagggaaaaattggtgacagccccagagcagatgacaagttggaggaa
tgggaaaacgtgaacgatgctattagagaattcgcaaagctctttgaagaactgacggga
gatcagttcgaaccatgggaaagagagaagaagattcataagaaaaatatgaagttcttc
cctattgatattgatgatggcgttgaagtaaggtgtggcggactaggccttaggcaactc
ggggttgctgcttcacatagtaagcttgatccgaaggtagcaaatttaatgaaagtcctc
tgtagccaggagatttaccggtatgctctagtggagatgggatatgattcacctgagatt
cctattgggatggttactgatcttcatttgagaagatgtgaggataccctcaaagaattt
gtggagaaactgaaatcttcaacgccaacggggaacaaagcagacgccgtttggggcgat
ttcacccaaagatggttcactctcataccgactacaaggccctttccctttaaagactat
gaagaacttgcagaccagggtgcttcttcttatgaggcgattcgagatatcaatactgcc
tcccgtcttataggagatatgtcaggctcaacgttggacgatcctctttttgagcgttat
atgaagctaaattgttctctttcacctcttgagaaagaggaagatgactacaaaatgata
gtgaagtacctggacaaaacttatgaaccagtgagcatcggcgatgttagctatggtgta
tcggttgagaatatctttgctgttgaagcaagtgcatgcccctctcttgatgacatcaag
aaattgcccaacaaggttctgttatggtgtgggactaggagttcaaatctattgagacac
ttgcagatgggattcttgccttcaacttgttcacttcctgtaccaggatacatgtttgga
agagccatcgtttgttcggatgctgcagcagaagcagccagatatggattcacagctgta
gataggccagaaggtttcttggttttggctgttgcctcactaggagaagaaatccaagag
ttctcaagtccacctgaggacactaaatctctggaggagaagggaattggagctaaaggg
cttggcaagaacaaaacagacgagtcagagcattttgtgtggaaggacaacattaatgtc
ccttgtggcaagttgattccatcagagcacaaggaaagccctctcgagtacaacgaatat
gctgtatatgatccacatcaggtaagcataaggttcttggtggaggtgaaattcgaggag
aaagacgtggagtatgaagcagttgagctcgagactgagcagcagcccgaggaataa

KEGG   Solanum pennellii: 107015088
Entry
107015088         CDS       T04130                                 

Definition
(RefSeq) poly [ADP-ribose] polymerase 1
  KO
K24070  poly [ADP-ribose] polymerase 1 [EC:2.4.2.30]
Organism
spen  Solanum pennellii
Pathway
spen03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    107015088
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spen03032]
    107015088
   03036 Chromosome and associated proteins [BR:spen03036]
    107015088
   03400 DNA repair and recombination proteins [BR:spen03400]
    107015088
Enzymes [BR:spen01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     107015088
DNA replication proteins [BR:spen03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     107015088
Chromosome and associated proteins [BR:spen03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    107015088
DNA repair and recombination proteins [BR:spen03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     107015088
SSDB
Motif
Pfam: PARP zf-PARP PARP_reg PADR1 WGR BRCT BRCT_2 PTCB-BRCT BRCT_3 NPV_P10 DUF3275
Other DBs
NCBI-GeneID: 107015088
NCBI-ProteinID: XP_015070742
LinkDB
Position
3
AA seq 992 aa
MANPPKPWKAEYAKSSRSACKTCKSIIDKEVFRIGKMVQSTHFDGLMPMWHHANCILRKA
KQLKSLEDVEGVDQLRWEDQQKIREYVQTGGSSNIPTPAAVECGIEVSPASRASCRHCNQ
KIVKGEVRISSKPEGQRAKSLAWHHAKCFSEISSTTQVEKLSNWDSLSAADQAAVLSLFK
SSTLTGNKTDPKEELAQESTSKAGAKRKKPSNNSEKSKVAKAEADVFTGKKVVDRNIDNV
KVELSKGSELESQLEAQTKALWALKDDLKKHVSTGELREMLEANDQESSGSELDLRDRCA
DAMHFGGLPKCPLCSGHLRYSGGMYRCHGYLSEWSKCSYSVTDIKRDKGKWKIPEETSNE
FLLKWYKGQKSKKPERILLPATPSKETVSQAGNGLSQSSKGENLGDLKVALTGLSRDSRE
NWKSKIEEAGGQVHAKLKKDTDCLVVIGTWNDQDSEIKKARRLKVSVVRENYLVDSINRK
KKLPFDLYKLEANSETQSMKTVKVKGRSAVHESSRLQDTGHILEDKTSIYNTTLNMSDLS
SGINSYYILQIIEEDKGSDCYVFRKWGRVGNEKIGGDKLEEMSKSDAIQHFKRLFLEKTG
NSWEAWEQKKNFQKQPGRFYPLDIDYGVDKKTTSKRNFNDTNCKLAPPLMELMKILFNVE
TYRAAMMEFEINMSEMPLGKLSKRNIQKGFEALTEIQNLLSGTNHDPTVKETLLVDASNR
FFTVIPSIHPHVIKDEDDFKLKIKMLEALQDIEIASRLVGFDIDNDDSLDEKYKKLQCDI
SPLPHQSEDYRVIEKYLQNTHAPTHKDWVLEVEEVFSLERKGEFDKFKPCRDKLKNKMLL
WHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADMVSKSAQYCFTDRKNPVGFML
LSEVALGEVYELKAAKYMDKPPRGKHSTKGLGKTVPERSEFVNWRDEVVVPCGKPVTSNV
KNSELLYNEYIVYDAAQVKLQFLVKVRFNFKR
NT seq 2979 nt   +upstreamnt  +downstreamnt
atggcgaatcctccgaagccatggaaagctgagtatgcaaaatcatctcgttcagcatgc
aaaacttgcaaaagtattattgacaaagaagttttcagaattggaaaaatggtccaatct
actcattttgatggattaatgccgatgtggcatcatgctaactgcatcttgaggaaagca
aaacagttaaaatcccttgaagatgttgaaggggttgaccagttgcggtgggaggatcag
cagaagataagggaatatgtacagactggtggatcctcaaacatccctactccggctgca
gtggaatgtggtattgaagtatctccagcctcgcgtgcttcctgtcggcactgcaaccaa
aagattgttaaaggggaggtacgcatatcatcaaaacctgaaggtcaacgtgctaagtcg
ctggcatggcatcatgcaaagtgtttctctgaaatatcttcgactacccaggttgaaaag
ctatctaattgggatagcctctcagctgctgatcaggcagctgttctatccctgtttaag
agttctacattgacgggtaacaaaactgatcccaaggaggaactagcacaggaatcaaca
tctaaggctggtgctaaaaggaaaaaacccagtaacaacagtgagaaatctaaggttgct
aaagccgaagctgatgtttttaccggcaaaaaagtggttgacagaaacattgacaatgtg
aaggttgaactctccaaaggatctgagctggagagccaactggaggcacagactaaagcc
ctatgggcactcaaggatgatcttaaaaagcatgtcagtacaggagagttgcgagagatg
cttgaagctaatgatcaggaatcttcaggatcagagcttgatcttcgagatcgctgtgcc
gatgcaatgcattttggagggctccccaaatgtcccctttgttcaggacaccttcgatat
tctggaggcatgtacagatgccatggctatttgtcagaatggagcaagtgttcatactct
gtcaccgacataaaacgtgataaaggaaaatggaaaattcctgaagaaaccagcaacgag
tttcttctcaagtggtataagggacaaaagtcaaaaaaaccagaaaggatactgcttccg
gctacacccagcaaggaaactgtgagccaggctggtaatgggctgtctcagtcttccaag
ggtgaaaatctaggggatctaaaagttgctttgacaggattgtccagagattccagggag
aactggaagagcaaaattgaggaagcaggtggacaggtgcatgccaagctgaagaaagac
acagattgcttagttgtaatagggacgtggaatgatcaagattctgagataaagaaggcc
aggagactgaaagtgtctgtagtcagggagaattatttggtggatagtatcaacagaaag
aaaaaacttccttttgacttgtataaattagaagctaatagtgagactcaaagcatgaaa
actgtcaaagtaaaagggaggagtgcggttcatgagtcatccagattgcaagatacagga
cacattcttgaggacaagaccagcatttataatacgactttaaacatgtcagacctctca
agtggtattaatagttactacatccttcaaattattgaagaggacaaagggtcagactgt
tatgtttttcgcaaatggggtcgtgttggaaatgagaaaattggaggagacaagttagag
gagatgtctaaatcagatgcaatacaacattttaagcgtttgtttcttgagaagactggg
aattcatgggaagcatgggaacaaaagaaaaatttccagaagcaacctggcagattttat
cctctggatattgattatggggttgacaaaaaaaccacctctaagagaaatttcaatgac
acaaactgcaaacttgcccctccattgatggagctgatgaagattctatttaatgttgag
acatacagggctgctatgatggaatttgagataaatatgtcggagatgccactaggaaag
ctgagtaaaaggaatatccaaaaaggttttgaggcattaacggagatacaaaatttgtta
agcggcactaatcatgatccaactgtcaaggagacccttcttgttgatgcaagcaatcgc
tttttcacagtcataccatctattcatcctcatgttattaaagatgaggatgattttaag
ttgaagataaaaatgctggaagctcttcaggacattgaaatagcttcacgacttgttggc
tttgacattgacaatgatgactcgctggatgagaagtataagaagctacagtgtgatata
tctccacttcctcatcaaagtgaagattatcgagttattgaaaagtatcttcaaaatact
catgctcctacacataaggactgggttctagaagtggaagaagtgttttctctcgaacgt
aaaggggaatttgacaagtttaaaccctgcagagataaactgaagaacaaaatgcttcta
tggcatggttcacgtttgacaaactttgtgggtatacttagccaaggactaagaattgct
cctccagaagcccctgctacggggtacatgtttggaaagggaatatactttgctgatatg
gtcagcaaaagtgcacaatattgcttcactgatcgcaagaaccctgttggatttatgctt
ctcagtgaagtagctttaggtgaggtttatgagctaaaggcagccaagtatatggacaaa
ccacctagaggcaagcactctactaagggtctgggcaagacagtacctgagagatcagag
tttgtgaactggagggatgaagttgtggttccgtgtggaaaaccagtaacatcaaatgtt
aagaactctgagcttctgtacaatgaatacatagtctacgacgctgcccaagtaaagctg
cagttcttagtcaaagtgaggtttaatttcaagcggtga

KEGG   Solanum pennellii: 107016634
Entry
107016634         CDS       T04130                                 

Definition
(RefSeq) poly [ADP-ribose] polymerase 3-like
  KO
K10798  poly [ADP-ribose] polymerase 2/3/4 [EC:2.4.2.30]
Organism
spen  Solanum pennellii
Pathway
spen03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    107016634
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spen03032]
    107016634
   03036 Chromosome and associated proteins [BR:spen03036]
    107016634
   03400 DNA repair and recombination proteins [BR:spen03400]
    107016634
Enzymes [BR:spen01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     107016634
DNA replication proteins [BR:spen03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     107016634
Chromosome and associated proteins [BR:spen03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    107016634
DNA repair and recombination proteins [BR:spen03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     107016634
SSDB
Motif
Pfam: PARP PADR1 PARP_reg WGR BRCT BRCT_2
Other DBs
NCBI-GeneID: 107016634
NCBI-ProteinID: XP_015072534
LinkDB
Position
1
AA seq 851 aa
MMILYIKILLVDTRRVLLLYILTLPWKKFDSATRFMQVKVHETRSQAHSTSEERKVMRKQ
QAESNSQETASHKKAKTDEEEEGVVHEDGIRAEFEKFCKTITEHLSVKQMREILEANGQY
SKGEDDAVVPRCQDIMFYGPLDNCPICGGKLECSGDGYHCVGDYSEWSSCIYSTKEPPRR
EESLKLPKSVESTPISDLIKKRGNPNKSRPRKEISSPKKPFDGMMVSLAGRLTRKHQYWK
SKIEKFGGKVNNSITGVACVVVSPAERDRGGSSKVAEALEKGIPVVREAWLNDSIEKEEA
QSLDAYDIASDIAVEGKGIPLDKMDPSAEALETVTAELKVFGKRGVHKDSKMQDEGARIL
EKDGLLYNCALSICNQKKKLNDFSIMQLIMSSENRLHMYLRRGRNGDSLRADDKLEEWEN
VDYAIKEFARLFEEMTGNEFEHWEREKEIHKKHHKFYPIDIDDGIEVRHGALGLRQLGSA
AAHSKLDSVVANFMKVLCSQEIYRYALMELGHDSPEIPIGMLTNFHLRRCEEILLHFVEK
IKSMKETGPEAEGVWHEFSQMWFTLVPSTRPFTFRDHTDLAEHAASAYETIRDINFASRI
IEDMSGSTLDDPLFECYKKLLCSVSPLEKESDDYKMIVNYLKKTYEPVQVGDMSYGISVE
NIFAVEVSACPSLDEIKELPNKVLLWCGTRSSNLLRHLQKGFLPSVCSLPVSGYMFGRAI
VCTDAAAEAATYGFTAVDRPEGFLVLAVASLGEEIKEFSSPPEDTRALEEKKIGVKGLGR
KKTNEKEHFVWKDDIKVPCGKLIPSEHKDSVLEYNEYAVYDPQQVSIRYLVAVKFNELDV
VYDTAEPEPEQ
NT seq 2556 nt   +upstreamnt  +downstreamnt
atgatgatattatatataaaaattctattggtcgacacccgtcgtgtgttacttctttat
attttgacacttccttggaaaaaatttgactccgctactcgatttatgcaagtgaaggtt
catgagacccgatctcaagctcactcgacaagcgaagagagaaaggtgatgaggaagcag
caggcagagagcaacagccaagagacagcctcacacaaaaaggcaaaaactgacgaagaa
gaagaaggtgttgtccacgaagatggaatcagagccgagtttgagaaattctgtaaaact
ataaccgaacatctctccgtcaagcaaatgcgcgaaatccttgaagcaaatggccagtat
tctaaaggtgaagatgatgctgttgttcctagatgtcaagacataatgttctacgggcca
ctagacaattgtcctatatgtggtggcaagttggaatgctctggcgatggttatcattgc
gtcggagattatagtgagtggtcgagttgtatctacagcacgaaggaaccaccgagaaga
gaagagtctctcaaactccctaaatctgttgaaagtactccaatatctgatctgatcaag
aaacgtggaaatcctaacaagagtcgcccccgaaaggaaatatcttccccaaagaagcca
tttgatggaatgatggtatctctagctggtcgtcttactcgaaaacaccaatactggaaa
tcgaaaatcgagaaatttggtggaaaagtgaacaactctatcactggggttgcttgcgta
gtagtttctcccgctgaacgtgatcgtggtggctcatccaaagtagctgaagctttggag
aagggtataccggtagtgagggaggcttggttgaatgatagtatagaaaaggaagaagct
cagtctttagatgcatacgacatcgccagtgacattgctgtagaaggtaaaggtattccc
cttgataagatggatccaagtgcagaggcactcgaaaccgtaacagccgagcttaaagtg
ttcggaaaaagaggtgtacacaaagatagtaagatgcaggacgaaggcgcaagaatattg
gagaaagatggcttattgtataattgtgcgctgtctatttgcaaccaaaagaaaaaactc
aacgacttcagtattatgcaacttatcatgtcatcggagaatcgtttgcatatgtatctt
agaaggggcagaaatggtgatagtttaagagcagatgacaagttagaggagtgggaaaat
gtcgattatgcgattaaggagtttgctaggctctttgaagagatgactggaaatgagttc
gaacactgggaaagggaaaaggagattcacaaaaagcatcacaagttctaccctattgat
atcgatgacggaatagaggttaggcatggagcgcttggcctaaggcaacttggttctgct
gctgcacatagtaagcttgattcggtagtggcaaatttcatgaaagtcctttgtagccaa
gagatatacaggtatgctttaatggagctgggacacgattcaccggaaattcctataggg
atgcttactaattttcatctgagaagatgtgaagaaattctcctacacttcgtggagaag
ataaaatcaatgaaggaaacaggaccggaagcagagggtgtctggcacgagttcagtcaa
atgtggttcactctcgtgccatctacgaggccttttactttcagagatcataccgatctc
gcagagcatgctgcttctgcttatgaaactatccgcgacatcaactttgcctcgcgtatt
atagaagacatgtctggatctacgctcgatgatcctctcttcgagtgttacaagaaactc
ctgtgttcagtttctcccttggagaaagaatctgatgactacaaaatgatagtgaactac
ttgaagaaaacttacgagccggtccaagttggagatatgagctacggcatatcggttgag
aatatatttgctgttgaagttagtgcttgtccttcccttgatgagatcaaggaattacca
aacaaagttcttctctggtgtggtacgaggagttcaaatcttttgaggcacctgcagaaa
ggtttcttgccttcagtttgttcacttcccgtatcgggatacatgtttggaagagccatc
gtttgcacggatgcagcagcagaagcagcaacatatggtttcacagctgtagataggcca
gaaggtttcttggttttagccgttgcttcactcggtgaagaaattaaggagttttcgagt
cctcccgaggatactcgagcattggaagagaagaaaatcggagtaaaaggacttggaagg
aagaaaacgaacgagaaagaacattttgtctggaaggatgatattaaggtaccgtgcggt
aagctgattccatcggagcacaaggatagtgtcctcgagtacaacgaatacgccgtctat
gatccacagcaggtgagtataaggtacttagtggcggtaaaattcaacgagctggatgta
gtatacgacacagctgaacccgaacccgagcaataa

KEGG   Solanum pennellii: 107027002
Entry
107027002         CDS       T04130                                 

Definition
(RefSeq) poly [ADP-ribose] polymerase 2-like
  KO
K10798  poly [ADP-ribose] polymerase 2/3/4 [EC:2.4.2.30]
Organism
spen  Solanum pennellii
Pathway
spen03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    107027002
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spen03032]
    107027002
   03036 Chromosome and associated proteins [BR:spen03036]
    107027002
   03400 DNA repair and recombination proteins [BR:spen03400]
    107027002
Enzymes [BR:spen01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     107027002
DNA replication proteins [BR:spen03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     107027002
Chromosome and associated proteins [BR:spen03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    107027002
DNA repair and recombination proteins [BR:spen03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     107027002
SSDB
Motif
Pfam: PARP PARP_reg SAP WGR SAP_new25 Rho_N SatRNA_48 Enkurin
Other DBs
NCBI-GeneID: 107027002
NCBI-ProteinID: XP_015083642
LinkDB
Position
8
AA seq 757 aa
MATITKLKVDELRKELSSRGLDTTGTKPILVKRLEEAIEVDEEENKKKLNVDKKRSRVDS
DSIGSGKMYDVEEYKKMSVKELREVATSRGILSSGSKKELVERLCAAADLRKNDPKDDLG
VGDEGKAEKLVRTTKKGAAVLDQYLSDDIKERQHVLQQEKRLEEAIEEEEEENKKKLNGD
KKRSRVDSDSIGSGKMNTVEEYKKMSVKELRDVATSRGISSTGSKKELVERLCAAADSHK
NDSKDDLGVGDEGEIEKLVTATKKGAAVLDQYLSDDIKERYHVLQQGNDIYDATLNQTNV
GNNNNKFYIIQVLENDSGGNFLVYTRWGRVGAKGGTKISGPYTSADDATSEFESKFYDKT
KNDWSNRKDFFCQPKHYTWLEMDYAETGKDSSAQGQSNPVHKSQPRETKLEAPIAKFISL
ICDINMMRQQMMEIGYNANKLPLGKLSKTTILKGYDVLKNIADVIGQSNRRLLEDLSSQF
YTVIPHDFGFKKMREFVIDTPQKLKRKIEMVEALAEIEVATKLLEDNTEIQEDPLYYQYE
QLRCKLVPVEVGSQEFLMIESYMKNTHAKTHSGYAVDIVQVFRASRDGETERFQKFSDTS
NRMLLWHGSRLTNWAGILSQGLRIAPPEAPSTGYMFGKGVYFADMFSKSANYCYASSAAK
NGVLLLCEVALGDMNELLSANYDADKLPSGKLSTKGVGATAPDPKASQILEDGVVVPLGN
PKNQRKQGSLLYNEFIVYNVEQIRMRYVIQVEFNYGV
NT seq 2274 nt   +upstreamnt  +downstreamnt
atggcaaccattaccaagcttaaagtcgacgaacttcggaaggagctctcaagtcgcggt
cttgataccacaggaaccaaacctatactggttaagaggttggaagaggcgattgaggtg
gacgaggaggaaaataagaagaaattgaatgttgataagaaaaggtcgagggttgattct
gactcaattgggtcagggaaaatgtatgatgtggaggagtataagaaaatgagtgttaag
gagttaagggaggtagctacttctcgtgggattttaagttctgggtcgaagaaagaactt
gttgagaggctttgtgctgctgctgatttacggaaaaatgatccaaaagatgatcttgga
gttggagatgaaggcaaggcagagaaattggtcagaacaacaaagaaaggtgcagctgtt
ttggatcaatatctgtcagatgacatcaaagaacggcagcatgtcctgcaacaagaaaag
aggttagaggaggctattgaggaggaggaggaggaaaacaagaagaaattgaatggtgat
aagaaaagatcaagggttgattctgattcaattgggtcagggaaaatgaataccgtggag
gagtataagaaaatgagtgttaaggagttaagggacgtagccacttctcgtgggatttca
agtactgggtcgaagaaagaacttgttgagaggctttgtgctgctgctgattcacacaaa
aacgactcgaaagatgatcttggagttggagatgaaggcgagatagagaaattggtcaca
gcaacaaagaagggtgcagctgttttggatcaatacctgtcagatgacatcaaagaacgg
taccatgtcctgcaacaaggcaatgatatttatgatgccacattgaaccaaacaaatgtc
gggaacaacaataacaagttttatatcattcaagttctagagaatgatagtggtgggaat
ttccttgtttacactagatggggtagagttggtgcaaagggtggaacaaagattagtggt
ccctacacgtctgccgatgatgccacatctgagtttgagagtaaattctatgataagact
aagaacgattggtctaaccgcaaagattttttttgtcaacccaagcattatacttggttg
gaaatggactatgctgaaactgggaaagactcctcagcccaaggacagtccaacccagta
cataaaagtcaaccccgtgagactaagctggaggccccgattgcaaagttcatatctctt
atttgcgacatcaatatgatgaggcagcaaatgatggaaataggatataatgctaacaag
ttgccactcggtaaattgagcaagactactattttaaagggctatgatgtcttgaaaaat
attgctgatgtgattggccagtccaacagacgtctgcttgaagatttgagtagtcaattc
tatacagtcattcctcatgattttggattcaagaagatgcgtgaatttgtcatcgacacc
cctcagaagttaaaacgcaaaattgaaatggtcgaagctcttgctgaaattgaagttgca
actaagttattggaggataacacagagatacaggaggatcccttgtattatcaatatgaa
caacttcgttgcaaacttgttccagttgaagttggttcccaagagtttctcatgattgag
agttacatgaagaatacccatgcaaaaacacattctggttatgctgttgatattgttcaa
gtatttagggcatcaagagatggtgaaactgaaagattccagaagttctctgatacgagt
aataggatgcttttatggcatggttctcgcctcacaaactgggctggcattctttcacag
ggtttacgaattgctcctccagaagcaccttcaacagggtacatgtttgggaaaggtgtt
tattttgctgatatgttctccaaaagtgcaaattactgctatgcttcctctgctgctaag
aatggtgtccttctattgtgcgaggttgctcttggtgatatgaatgagctgctgtcagca
aactacgatgctgataagttgccttcgggaaagctaagcaccaaaggagtcggtgccacg
gccccagatcctaaagcatctcaaatacttgaagatggtgtcgttgttcctttgggaaat
ccaaagaatcaacgaaagcagggtagtttattgtataatgaattcatagtttacaacgtg
gaacaaataagaatgcgttatgttatccaggttgagttcaattacggagtataa

KEGG   Solanum pennellii: 107027814
Entry
107027814         CDS       T04130                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 2-like
  KO
K10798  poly [ADP-ribose] polymerase 2/3/4 [EC:2.4.2.30]
Organism
spen  Solanum pennellii
Pathway
spen03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    107027814
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spen03032]
    107027814
   03036 Chromosome and associated proteins [BR:spen03036]
    107027814
   03400 DNA repair and recombination proteins [BR:spen03400]
    107027814
Enzymes [BR:spen01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     107027814
DNA replication proteins [BR:spen03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     107027814
Chromosome and associated proteins [BR:spen03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    107027814
DNA repair and recombination proteins [BR:spen03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     107027814
SSDB
Motif
Pfam: PARP PARP_reg WGR Enkurin
Other DBs
NCBI-GeneID: 107027814
NCBI-ProteinID: XP_015084364
LinkDB
Position
8
AA seq 587 aa
MNVVEYKKISINDQVNPYIRTKKKFVDRLCIAADLQINDHLLVCWCCVNLLSKHSPELDG
VNLVCLIFRSVITGNFSVGDEGETEKLVTATKKGAAVLDQYLSDEIKALYHVLQQGNDIY
EATLNQTNVENNDNEFYIIQVLENDCGGNFLVYTRWGRVGEKGETKISGPYTYAGDATSE
FEHKFYEKTKNCWSNRNDFFCQPKQYAWLEMDYDENGEYSSIQGQSSLVPRSQPRETKLE
APIAKFISLICDINMMRQQMMEIGYNANKLPLGKLSKKTILKGYDVLKNIADVIGQSNRT
LLEDLSSQFYTVIPHDFGFQKMCEFVIDTPPKLKRKIEMVEALAEIEVTTKLLEDNTDIQ
EDPLFYQYEQLGCKLVPVEVGSQEYLMIESYMKNTHAKIHSGYAVDIVQVFRASRNGENE
RFQKFSDTSNRMLLWHGSRLTNWAGILSQGLRIAPPEAPSTGYMFGKGVYFADMFSESAI
YCYASSAAKNGVLLLCEVALGDMNELLSANSDADKLPLGKLSTKAVGATAPDFKEAQILE
DGVIVPLGNPKERPKHEGNLLHNEYIVYNVEQIRMRYVIQVEFNYEI
NT seq 1764 nt   +upstreamnt  +downstreamnt
atgaatgttgtggagtataagaagataagtattaatgatcaggtgaatccttatattcga
acgaagaaaaaatttgttgacaggctttgtattgctgctgatttacagattaacgatcat
ctactagtttgctggtgttgtgtgaacttactctcaaaacattcgccggagctcgacggc
gtcaatctggtctgcttgattttccggtcggtaattaccggtaacttttcagttggagat
gaaggcgagacagagaaattggtcacagcaacaaagaagggtgcagctgttttggatcaa
tatctgtcagatgaaatcaaggcattataccatgtcctgcaacaaggaaatgatatttat
gaggccacattgaaccaaacaaatgttgagaacaacgataacgaattttatatcattcaa
gttcttgagaatgattgtggtgggaatttcctcgtttacactagatggggtagagttggt
gaaaagggtgaaacgaagatcagtggtccctatacgtatgccggtgatgccacatctgag
tttgagcataaattctatgagaagaccaagaactgttggtctaaccgcaatgattttttt
tgtcaaccaaagcaatatgcttggttggaaatggactatgatgaaaatggggaatactca
tcaatccaaggacagtccagtctagtaccaagaagtcaacctcgtgagactaagctggag
gccccgattgcaaagttcatatctcttatttgtgacatcaatatgatgaggcagcaaatg
atggaaatagggtacaatgctaacaagttgccactcggtaaattgagcaagaaaactatt
ttaaagggctatgatgtcttgaaaaatattgctgatgttataggccagtccaacaggaca
ctgcttgaagatttgagcagtcaattctatacagtcattcctcatgattttggattccag
aagatgtgtgaatttgtcattgacacccctccgaagttaaaacgcaaaattgaaatggtc
gaagctcttgctgaaattgaagtcacaactaagttattggaggataacacagatatacag
gaggatcccttgttttatcaatatgaacaacttggttgcaaacttgttccagttgaagtt
ggttcccaggaatatctcatgattgagagttacatgaagaatacccatgcaaaaatacat
tctggttatgctgtcgatattgttcaagtatttagggcatcaagaaatggtgaaaatgaa
agatttcagaagttctctgatacgagtaataggatgcttttatggcacggttctcggctg
acaaactgggctggaattctttcacagggtttaagaattgctcctccagaagcaccttcg
acagggtacatgtttgggaaaggtgtttactttgctgatatgttctccgagagtgcaatt
tattgctatgcctcatcggctgctaagaatggtgtgcttttgttgtgcgaggttgctctt
ggcgacatgaatgagctgttgtcagccaactccgatgctgataagttgcctttgggaaag
ctaagcacaaaagcagtcggtgccacggccccagattttaaagaagctcaaatacttgaa
gatggtgtcatcgttcctttgggaaatccaaaggagcgacccaaacacgagggtaatttg
ttgcataatgagtacattgtttacaatgtggaacaaataaggatgcgctatgttatccag
gttgagttcaattatgaaatataa

DBGET integrated database retrieval system