KEGG   Solanum pennellii: 107004942Help
Entry
107004942         CDS       T04130                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
spen  Solanum pennellii
Pathway
spen04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:spen00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107004942
Enzymes [BR:spen01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     107004942
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 107004942
NCBI-ProteinID: XP_015058855
LinkDB All DBs
Position
11
AA seq 217 aa AA seqDB search
MAAHSIFTTTSTTNSFLYPVSSSSSSPNINSSFHGVSLNVKSKFGQSLTLYAVTTPKPLT
VFAATKKAVAVLKGNSNVEGVVTLSQDNDGPTTVNVRITGLAPGLHGFHLHEYGDTTNGC
MSTGAHFNPNKLTHGAPGDEIRHAGDLGNIVANADGVAEVTLVDNQIPLTGPNSVVGRAL
VVHELEDDLGKGGHELSLTTGNAGGRLACGVVGLTPI
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggccgcccactcaatcttcaccacaaccagcactaccaattctttcttatacccagtt
tcttcttcttcttcttcccctaacattaactcttctttccatggtgtttcacttaatgtt
aagtcaaaatttggccaatctttgaccctttatgctgtcactacccctaaaccccttact
gtttttgctgctactaagaaagctgttgctgtccttaagggcaactctaatgttgagggg
gttgtcactctatctcaagataatgatggtccaactacggttaatgttcgtataactgga
cttgctcctggacttcacgggtttcatttacatgaatatggtgacactacaaacgggtgt
atgtctacaggagcccattttaatccgaataaattgacacatggagctcctggagatgaa
atccgtcatgcgggtgacctgggaaacatagtggccaatgccgatggcgtggctgaagtg
acacttgtagataatcagataccattgaccggtccaaactcagttgttggaagagcactt
gtagttcatgagcttgaggatgacctcggaaagggtggccatgaactcagccttaccact
ggcaatgctggtggacgattggcatgcggtgtggttggtttgactccaatatga

DBGET integrated database retrieval system