KEGG   Solanum pennellii: 107005036Help
Entry
107005036         CDS       T04130                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
spen  Solanum pennellii
Pathway
spen03030  DNA replication
spen03410  Base excision repair
spen03420  Nucleotide excision repair
spen03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107005036
   03410 Base excision repair
    107005036
   03420 Nucleotide excision repair
    107005036
   03430 Mismatch repair
    107005036
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spen03032]
    107005036
   03400 DNA repair and recombination proteins [BR:spen03400]
    107005036
Enzymes [BR:spen01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     107005036
    6.5.1.6  DNA ligase (ATP or NAD+)
     107005036
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     107005036
DNA replication proteins [BR:spen03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    107005036
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     107005036
DNA repair and recombination proteins [BR:spen03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     107005036
   NER (nucleotide excision repair)
    Other NER factors
     107005036
   MMR (mismatch exicision repair)
    Other MMR factors
     107005036
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 107005036
NCBI-ProteinID: XP_015058981
LinkDB All DBs
Position
11
AA seq 801 aa AA seqDB search
MLCLSSYRFTQTTLLYNFSVKPSSIFLHFYKKKQSTLKPLFFSVNPNSNSRTMSDSPPAP
PRSAFAVLMANSKKKTTSSPKKRKTPDVETSSKSPVVNQDSVLKPIKDTHLVNESKSEEL
EVKKQSQDSTLKPIEDTHLVNESKSEECVVKKRKMISPDESIVEIKKKAANFDPRKAVYW
GDGQRVPFMFVVKAFDAISKESGRIVITEIVTNMLRTVIETTPEDLLPVVYLAANKIAAA
HDGMELGIGDASIIKALAEACGAKEAHIKKQYKELGDLGLVAKASRSSQPLMHKPEALTV
AKVFDTFRIIAKESGKDSQEKKKNYIKSLLVAATDCEPQYLIRLLQTKLRIGLAEQTLLV
AIAHAFVYSDKHSSPPAGVDSPLEEAAKIVKQVYSVIPVYEKIIPALLADGVWKLSETCG
FSPGVPVGPMLAKPTKGVSEILDKFQDMEFTCEYKYDGERAQIHYMEDGSVEIYSRNAER
NTGKFPDVVTAISRLKKSSATSFVLDCELVAYDREKQKILPFQVLTTRARKNVVISEIKV
NVCIYAFDILYLNGQPLLQEQLNVRREHLYKSFEEEPGYFQFATAVTSNDLEEITKFLED
AVNGSCEGLIIKTLTKDATYEPSKRSNNWLKLKKDYMESIGDSLDLVPIGAFHGRGKRTG
VYGAFLLACYDSNNEEFQSICKIGTGFSELQLEERSSSLRSKVIPKPKSYYRYGETINPD
VWFEPTEVWEVKAADLTISPVHRAAQGIVDPAKGISLRFPRLSRVREDKKPEEASSAEMV
ADMYNAQKHNQKNNQDDNDED
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgtttgagttcatatcgtttcactcaaactactcttctttacaatttctccgtt
aaaccttcttcaatctttcttcatttctacaagaagaagcagtcaactctcaaacccctt
ttcttctctgtaaaccctaattcaaattcaagaaccatgtctgattctcctcctgctcct
cctcgctctgcgtttgcagtacttatggcaaattccaagaagaaaacaacctcctcacct
aagaaacgtaaaaccccagatgttgaaacttcaagtaaaagccctgttgttaatcaagat
tcagttttgaagccaattaaggacacccatttggtcaatgagtcgaaaagtgaggagttg
gaggtgaagaaacagagtcaagactcaactttgaagccaattgaggacacccatttggtt
aatgagtcgaaaagtgaggagtgtgtggtgaagaaacggaaaatgattagtccagatgag
agcattgtggaaataaagaaaaaagctgcgaactttgatccaagaaaggctgtgtattgg
ggagatggtcagagagtgccgttcatgtttgtagttaaggcgtttgatgcaatttcgaag
gagtcagggcggattgtgatcactgaaattgtgactaatatgttgaggactgtgattgag
acgacgcctgaggatttgttgcctgttgtgtaccttgctgctaataagattgcagctgca
cacgatgggatggagcttggtattggtgatgcttccattatcaaggcacttgctgaagcc
tgtggtgctaaagaagcacatatcaagaagcaatacaaggagcttggagatttgggcctt
gttgcaaaagcaagtcgttcatcacagcctctgatgcataaaccagaagcactgactgtt
gccaaagtttttgacacatttcggatcattgccaaggaatctggaaaggatagtcaggaa
aagaaaaagaattacattaaatcactgcttgttgcagccactgattgtgaaccccaatat
ttgattcgtcttctccagacaaagctacgcattggtttggctgaacaaacactgttagtc
gcaatcgctcatgcttttgtgtactcagataagcattcatcacctcctgcaggtgtagat
tctcctttggaagaggctgccaagattgttaagcaagtgtactctgtgattccagtttat
gaaaaaattatccctgctcttctagctgatggtgtttggaagctttcagaaacatgcggt
ttctcacctggtgttcctgttggacctatgctagctaagccaaccaaaggagtatctgaa
attcttgataagtttcaggatatggagttcacatgtgaatacaagtatgatggtgaacgt
gcccagatacactacatggaagatggttccgttgagatatacagccgaaatgcagaaaga
aatactggaaagtttcctgatgttgttactgctatctcaagattgaagaaatcatctgca
acttcatttgttcttgactgtgaactggttgcatacgaccgtgagaaacagaagatcctg
ccctttcaggtccttactacacgtgctcgtaaaaatgttgtcattagtgaaatcaaggtc
aacgtgtgcatatatgcttttgatatcttgtatcttaatggacaaccacttcttcaagag
caacttaatgttcgcagagagcatctttacaagtcatttgaagaagaacctggatatttc
cagtttgctacagctgtaacctcaaatgatctcgaggaaataacaaaatttcttgaagat
gcggtcaacggcagttgtgagggattgattatcaaaacactaactaaagatgctacatat
gagccttcaaaacggtcaaataactggctaaaactgaagaaggactacatggagagtatt
ggcgactcactggatctggtaccaattggtgcttttcatggtcgggggaaacgtactggt
gtttacggagcctttctcctagcttgttatgatagcaacaacgaggagtttcagagcatc
tgtaaaatcggaactgggttttctgaactacagcttgaggaacgctcttccagccttcgt
tctaaagttattcctaaaccaaagtcatattacaggtatggggaaaccatcaatccagat
gtttggtttgaacctaccgaggtctgggaagtgaaagctgctgatcttactatcagccct
gtccaccgtgctgcccaaggtatcgtggatcccgcgaagggaatttcgttacgatttcca
cgtctgagccgtgtacgagaagacaagaagcctgaggaggcctcatcagcagagatggta
gcggatatgtataacgctcagaaacacaatcaaaaaaacaatcaggatgacaacgatgaa
gactaa

DBGET integrated database retrieval system