Solanum pennellii: 107005460 Help Entry 107005460         CDS       T04130                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism spen  Solanum pennellii Pathway spen04136   Autophagy - other Brite KEGG Orthology (KO) [BR:spen00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     107005460  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:spen04131]     107005460    04121 Ubiquitin system [BR:spen04121]     107005460    03029 Mitochondrial biogenesis [BR:spen03029]     107005460 Membrane trafficking [BR:spen04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     107005460 Ubiquitin system [BR:spen04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    107005460 Mitochondrial biogenesis [BR:spen03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     107005460 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 DUF4264 Motif Other DBs NCBI-GeneID:  107005460 NCBI-ProteinID:  XP_015059544 LinkDB All DBs Position 12:60496213..60503188 Genome browser AA seq 90 aa AA seqDB search MAADSRKVIVHLRATGDAPILKQAKFKIAGTDKFIKVIDFLRRQLHRETLFVYVNSAFSP NPDELVIDLYNNFGFDGKLVVNYACSMAWG NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggctgccgattctcgaaaagtgattgttcatttaagagccactggcgatgctccgatt cttaaacaagcgaaattcaagattgcaggtactgacaaattcatcaaagtaatagatttt ttgcgccgtcaactccatagagagacattgtttgtgtatgtcaacagcgccttctcacca aatccagatgagttggtaattgatctatacaataactttggttttgatggtaagttggtg gtcaattatgcatgctctatggcgtggggctga

DBGET integrated database retrieval system