KEGG   Solanum pennellii: 107008783
Entry
107008783         CDS       T04130                                 

Definition
(RefSeq) methyl-CpG-binding domain protein 4-like protein isoform X1
  KO
K10801  methyl-CpG-binding domain protein 4 [EC:3.2.2.-]
Organism
spen  Solanum pennellii
Pathway
spen03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    107008783
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spen03036]
    107008783
   03400 DNA repair and recombination proteins [BR:spen03400]
    107008783
Enzymes [BR:spen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     107008783
Chromosome and associated proteins [BR:spen03036]
 Eukaryotic type
  Heterochromatin formation proteins
   MBPs (metylated DNA binding proteins)
    107008783
DNA repair and recombination proteins [BR:spen03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     107008783
SSDB
Motif
Pfam: HhH-GPD
Other DBs
NCBI-GeneID: 107008783
NCBI-ProteinID: XP_015063436
LinkDB
Position
2
AA seq 544 aa
MDGRQDNKGKKRRKKHREKYCEEEGKIVKSSPYFKKVPVHEDIGSSKSIEAFSDLYMKPI
KSECMVIAETHQRSNKRKRKKNSERVDDEKSGNDNREMDAKPILIGPPVTNLEVINEKEN
KQSGDLDEGCSSVASISVVRGDNAVAISLDDLFSKFAYKDGNFSSSKRRTEDEKIVVKSH
VCGPLSRTLISMQKSSETGSMIGNESHLSHWEGGCGPKAGKTVFEPCLSQNQINEKMIEQ
KARVVSPYFLDSRNGETEGCGLKAGKTVFEPCLSQNQINEKMIEQKARAVCPYFLNSRNG
DTEMKKGRSVECVKKRNDKKLRTKVRVVSPYFANLKVGEEIKVGKDSSNASKNCLNGRKV
SPYFQNAYREKKKSTIGSKRQKPCLSASQKRDEAYLRRSEDNMWVPPRSHFNLLQENHAH
DPWRVLVICMLLNCTTGVQVRRVVDEFFTLCPNAVAATEVAVEDIEKLLRPLGLYTKRSL
SIPRLSQEYLGKNWTHVTQLHGIGKYAADAYAIFCTGNWDQVYPNDHMLTKYWEFLHANG
SAST
NT seq 1635 nt   +upstreamnt  +downstreamnt
atggatgggaggcaggataataaaggaaagaagagaaggaagaagcacagggagaaatat
tgtgaagaggaaggaaaaattgtgaaatcttccccatattttaagaaagtgcctgtccat
gaggatattggaagtagtaaatccattgaagctttttctgatttgtatatgaagcctatc
aagagtgagtgcatggttattgctgaaacacatcagaggagtaacaaaaggaagagaaaa
aagaattctgaacgtgttgatgatgagaaatcaggaaatgataacagagaaatggatgcc
aaaccaatcctgattggtcctcctgttacaaatttggaagttattaatgagaaggagaat
aaacaatctggtgatttggatgagggatgttctagtgttgcttcaatttcagttgttcgt
ggtgataatgcagtggccattagtcttgatgatctcttttcaaagtttgcatacaaagat
ggaaactttagttccagtaaaaggagaactgaagatgagaagatagtcgtcaagtcacat
gtttgtggccctctctctcgaacgctcatctccatgcagaagtcttcagaaactggttct
atgattggaaatgagagtcatttatcacattgggaaggaggctgtggaccgaaagctggt
aaaactgtgttcgagccttgcttatctcagaatcagatcaatgagaagatgattgaacag
aaagcacgagtggtttccccttactttttggactcaaggaatggagaaactgaaggttgt
ggcctgaaagctggtaaaactgtgttcgagccttgcttatctcagaatcagatcaatgag
aagatgattgaacagaaagcacgagcggtttgcccttactttttgaactcaaggaatgga
gatactgaaatgaaaaaaggtaggtctgtagaatgtgtgaagaaaagaaatgataaaaaa
ttacgaaccaaagttcgagtggtttccccttactttgctaacttaaaagtgggagaagaa
ataaaggtaggtaaggatagttcaaacgcttcgaagaactgtctcaatggaagaaaggtt
tctccctactttcagaatgcatatcgtgaaaagaagaagagtacaataggttcaaaaaga
cagaaaccttgtctctctgcttcccagaaaagagacgaggcatatttaaggaggagtgaa
gataacatgtgggtacctcctcgatcccattttaatctcctccaagaaaaccatgctcat
gatccttggagggtgttggttatttgcatgcttttgaattgcaccaccggtgtgcaggtt
aggagagtggtagacgagtttttcactctgtgtccaaatgctgtggcagcaacagaggtt
gctgtagaggatatagaaaagttgctgcgacctttaggattatatacaaagaggtcactg
tctattccacggctctctcaagaatatcttggaaaaaattggactcatgtcacacagctg
catggtattggcaagtatgcagctgatgcatatgcaatattttgtacgggcaattgggat
caagtatatccaaatgatcacatgctaacaaaatactgggaattcctgcatgcaaatggc
tcggcctcaacctga

DBGET integrated database retrieval system