KEGG   Solanum pennellii: 107009241Help
Entry
107009241         CDS       T04130                                 

Definition
(RefSeq) alpha-glucosidase-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
spen  Solanum pennellii
Pathway
spen00052  Galactose metabolism
spen00500  Starch and sucrose metabolism
spen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107009241
   00500 Starch and sucrose metabolism
    107009241
Enzymes [BR:spen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     107009241
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 107009241
NCBI-ProteinID: XP_015064031
LinkDB All DBs
Position
2
AA seq 900 aa AA seqDB search
MKGIQFPSLNRNTFIILFLIHLSIFSPYFAISIKQKEAQQQVIGYGYSIKSVVTTGNSLF
ANLQLINTTSVFGSDIYNLILIASLETNDRLRIRITDVNHQRWEVPEEILRRPPPPSPPS
TSNSSSENHSPITLSNPNSDLEFTLHNTTPFSFTVRRRSTGDTLFDTSPENENPDAFLIF
KDQYIQISSALPTTRANLYGLGEHTKSSFKLTHNQTLTLWNADIGSSNADLNLYGSHPFY
MDVRSSDPAKETAAGVSHGVLLLSSNGMDIVYTGDRIIYKVIGGLIDLYFFXPEMVVDQY
TQLIGRPAAMPYWSFGFHQCRWGYKNIDDVELVVGSYAKARIPLEVMWTDIDYMDGFKDF
TLDPVNFPLERVNFFLRKLHQNDQKYVLIVDPGISINNTYDTYRRGVEADVFIKRDNMPY
QGVVWPGNVYYPDFLNPATEIFWRNEIEKFQDLVPFDGLWLDMNELSNFITSPPTPSSTF
DDPPYKINNSGDHLPINYRTVPATSTHFGNTIEYNVHNLYGLLESRATYSALVNVTGKRP
FILARSTFLGSGRYTSHWTGDNAATWNDLAYSIPTILNFGLFGIPMVGADICGFSSNTTE
ELCRRWIQLGAFYPFARDHSAKDTTPQELYSWDSVAAAAKKVLGLRYQLLPYFYMLMYKA
HTKGTPIARPLFFSFPQDAKTFDISTQFLLGKGVMISPVLKQGATSVDAYFPAGNWFDLF
NYSRFVSLNQGTYLTLDAPPDHINVHVREGNILVMQGEAMTTQAAQRSAFKLLVVLSSSK
NSTGELFVDDDDEVQMGREGGRWTFVKFNSNIIGNKIVVKSEVVDGRYALDQGLVLEKMT
LLGLENVRGLKSYELVGSHQQGNTTMKENLKQSGQFVAMEISEMSILIGKEFKLELYIIT
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaatacaatttccatctttaaacagaaacacctttataatcttatttttgatc
catttatcaatattttcaccatattttgccatatccattaaacagaaagaagctcaacag
caagtaattggctatggttactcaatcaaatctgtggtcaccactggaaattcacttttt
gctaatcttcaactcatcaacactacttctgtttttgggagtgatatttacaatcttatc
ctcattgccagtttggaaacaaacgatcgtctccgaatacgaataacggacgttaaccac
cagcgatgggaagtgccggaagaaattctccgccgtccaccaccgccatcgccgccgtca
acttccaactcctcatcagaaaaccactccccaattacgctctctaacccaaactcagac
ctagagttcacccttcacaacaccaccccattcagcttcaccgtccgccggcgctccacc
ggggatactcttttcgatacttcgccggagaacgaaaaccccgatgcattcctcatattc
aaagatcaatacatccagatctcctcggcactaccaactaccagagctaacctttacggg
ctcggagagcacactaaaagctcgtttaagcttacgcacaaccagactttgactctatgg
aatgccgacattgggagttccaacgcggaccttaatctctatggatcccatcctttttat
atggacgtccggtcgtcggatccggcgaaggaaacggccgccggagttagtcatggggtt
ttgcttctgagtagcaatggcatggatattgtatatacgggtgataggattatttacaag
gtgattggagggttaattgatttgtatttcttcnngccggaaatggtggtggatcagtat
actcagcttattggtcgtcctgctgctatgccatattggtctttcggatttcaccaatgc
cggtggggttacaagaatattgatgatgttgaactggtagtgggaagttatgcaaaggct
aggataccgctggaggttatgtggactgatattgattacatggatggttttaaggacttc
acactcgatccagttaacttcccactggagcgggtaaatttttttctcaggaagcttcat
cagaatgatcagaaatatgtactaatagtagatccaggaattagtatcaacaatacatat
gacacctacaggagaggcgtggaagcagatgtcttcataaaacgcgataatatgccctac
caaggggttgtttggccagggaatgtttattatcctgattttctaaatccagctactgaa
atattttggagaaatgaaattgagaagttccaggatctcgtaccttttgatggcctgtgg
cttgacatgaatgaattgtcaaacttcattacttcccctcctacaccatcatccaccttt
gatgaccctccgtacaagataaacaactctggcgatcacttgcccatcaattatagaaca
gttccagccacttcaacacattttggtaatacaatagagtataatgtccataacctttat
ggattactagaatctagagccacctatagtgctttggttaatgtcactggtaaaaggcca
ttcattcttgcaagatcaacttttcttggctctggcagatatacgtcacattggactgga
gacaatgctgctacatggaatgatttggcatactccattcctactatcttgaactttgga
ttgtttggaattccaatggttggagctgatatatgtggtttttcaagtaacactactgaa
gagctttgccgccgctggattcagcttggagcattctatccatttgcaagagaccactct
gctaaggacacaaccccccaagagctctatagttgggattcagttgctgcagcagccaag
aaagtccttgggctccgatatcagttacttccgtacttttatatgcttatgtacaaggca
catacaaaagggactcccattgcacgacccctcttcttctctttccctcaagatgccaag
acatttgatatcagcacacagttccttctcggtaaaggtgtcatgatctcaccggtactt
aagcaaggagcaacctctgttgatgcatatttccctgctggaaactggtttgacctcttc
aattactctcgcttcgtgagtttgaatcaaggaacatatctgacacttgacgcaccacca
gatcatataaatgtacacgttcgtgaagggaacatattggtcatgcaaggggaagcaatg
acaacacaagctgcacagaggtctgcattcaaactccttgtcgtgctgagcagcagcaaa
aacagcacaggagaactatttgtggacgatgacgatgaggtgcagatgggaagagaggga
gggaggtggacgttcgttaagtttaacagcaatatcattggcaataaaattgtggttaaa
tccgaggttgtggacggacgatacgcgctggatcaaggattggtccttgaaaagatgaca
ttattaggtttggaaaatgtgagaggattgaagagctatgagcttgttggatcacaccag
caagggaacacaacaatgaaggaaaatcttaaacagagtggacagtttgttgctatggaa
atctcagagatgtcaatactgatagggaaagagttcaaattggagctatacattattact
taa

DBGET integrated database retrieval system