KEGG   Solanum pennellii: 107010326Help
Entry
107010326         CDS       T04130                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain 2B, chloroplastic
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
spen  Solanum pennellii
Pathway
spen00630  Glyoxylate and dicarboxylate metabolism
spen00710  Carbon fixation in photosynthetic organisms
spen01100  Metabolic pathways
spen01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:spen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    107010326
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    107010326
Enzymes [BR:spen01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     107010326
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 107010326
NCBI-ProteinID: XP_015065088
LinkDB All DBs
Position
2
AA seq 180 aa AA seqDB search
MASSIVSSAAVATRANGAQASMVAPFTGLKSTASFPVSKKQNLDITSIASNGGRVRCMQV
WPPINMKKYETLSYLPDLSDEQLLSEIEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYD
GRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPEGY
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctctatagtttcttcagctgctgttgccactcgcgccaatggtgcacaagcc
agcatggttgcacccttcactggacttaagtccactgcttctttccctgtttcaaagaag
caaaaccttgacattacctccattgctagcaacggtggaagagtcagatgcatgcaggtg
tggccaccaattaacatgaagaagtacgagactctatcgtaccttcctgatttgtccgac
gagcaattgctcagcgaaattgagtacctattgaaaaatggatgggttccttgcttggaa
ttcgagactgagcacggatttgtgtaccgtgagaacaacaagtcaccaggatactacgat
ggcagatactggaccatgtggaagttgcccatgtttgggtgcaccgatgcaacccaggtc
ttggctgaggtgcaggaggcaaagaaggcttacccacaggcatgggtccgtatcatcgga
ttcgacaatgttcgtcaagtgcagtgcatcagtttcatcgcttacaagcccgaaggatac
taa

DBGET integrated database retrieval system