KEGG   Solanum pennellii: 107011073Help
Entry
107011073         CDS       T04130                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
spen  Solanum pennellii
Pathway
spen00020  Citrate cycle (TCA cycle)
spen00190  Oxidative phosphorylation
spen01100  Metabolic pathways
spen01110  Biosynthesis of secondary metabolites
spen01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:spen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107011073
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    107011073
Enzymes [BR:spen01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     107011073
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 107011073
NCBI-ProteinID: XP_015065883
LinkDB All DBs
Position
2
AA seq 629 aa AA seqDB search
MWRCVSRGLRASSNRSISGGGHFRRLFSSQTNVGGSSYTVVDHTYDAVVVGAGGAGLRAA
IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD
AIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAADRTG
HALLHTLYGQAMKHNTQFFVEYFALDLLMNSDGSCQGVIALNMEDGTLHRFRAANTILAT
GGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEGG
ILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPEVL
KERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGQVVTKKGNDPDAVIPGL
MAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIQNPGEKQKPLEKDAGERTIAW
LDKIRNSNGSLPTSKIRLDMQRVMQNNAAVFRTQETLEEGCQLIDKTWESFHDVQLKDRG
LIWNTDLIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDEKWMKHTIGYWED
EKVRLEYRPVHMNTLDDEVESFPPKARVY
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctgtgtgtcgcgtggtcttcgcgcttcctccaacagatctatctccggcggc
ggccattttcgccgactcttctcctcacaaactaatgtgggaggctcgtcctacacggta
gtcgatcacacatacgatgcggtggtggtcggtgcaggcggtgctgggcttcgtgcagca
atagggttgtctgagcatggattcaatactgcttgcataaccaagctctttcctactcga
tctcacactgttgcagctcagggtggtataaatgctgcattaggcaacatgacagaagac
gattggaggtggcacatgtatgatacagtcaaaggaagtgattggttaggtgatcaggat
gctatccaatacatgtgtagagaagctcccaaagcagttatagagcttgagaattatggt
ttgcctttctctcgaacagaagatggtaaaatatatcaacgtgcatttggtggtcaaagc
ctggacttcggaaaaggaggacaagcatatcgttgtgcatgcgctgcggatcggactggg
catgctctattgcatactctttatggccaggccatgaagcataatacacagttttttgtg
gaatattttgctttggatttactaatgaacagtgatgggagctgccaaggtgtaatagca
ctaaatatggaggatggtaccttgcatcgattccgtgctgccaatacaattttggccacc
gggggttatggccgagcttacttctcggcaacatctgctcatacttgcactggagatggt
aatgctatggttgcgcgtgctgggcttcctcttcaggatcttgagtttgtgcaatttcat
cccactggtatatatggggctggttgcctcattactgaaggatctcgcggtgaaggtggt
atcctgaggaatagtgagggtgagcgatttatggaaaggtatgccccaactgccaaggat
cttgcctcaagagatgttgtttccagatctatgactatggaaattcgagaagggcgtggt
gtaggacctttgaaggaccatatctatcttcacctcaatcacttacctccagaggttctt
aaggagagacttccgggtatctctgaaacagctgccattttcgctggtgttgatgtaact
aaggaaccaattcctgttttacctaccgtgcattataatatgggaggaatcccaactaat
taccatggccaggtggtcacgaaaaaggggaatgatccagatgctgtgatccctggactg
atggctgctggtgaagcagcatgcgcatctgttcatggtgccaatcgtcttggtgcaaat
tctcttctagatattgttgtttttggacgggcatgtgctaatagggttgcagagatacaa
aatccaggcgagaaacaaaagccacttgaaaaagatgctggagagaggaccattgcatgg
ttggacaagattaggaactcaaatggttcattgcccacctcaaagataaggctggacatg
caaagagttatgcaaaacaatgctgctgtcttccgcacacaagagacattagaggaaggt
tgccagctcattgacaaaacatgggagagttttcatgatgttcagttgaaggacagaggt
ttaatatggaacacagatcttatagagactattgagttggaaaatcttttaattaatgca
tgcatcaccatgcactcagccgaggcaagaaaagaaagcagaggagctcatgctcgtgaa
gattttacgaaaagagatgatgagaagtggatgaaacacaccataggatattgggaggac
gagaaagttcggctagaatacagaccagtgcatatgaacactcttgatgatgaagtcgag
tcgttcccaccaaaggctcgtgtctactga

DBGET integrated database retrieval system