KEGG   Solanum pennellii: 107011627Help
Entry
107011627         CDS       T04130                                 

Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
spen  Solanum pennellii
Pathway
spen03030  DNA replication
spen03410  Base excision repair
spen03420  Nucleotide excision repair
spen03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107011627
   03410 Base excision repair
    107011627
   03420 Nucleotide excision repair
    107011627
   03430 Mismatch repair
    107011627
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spen03032]
    107011627
   03400 DNA repair and recombination proteins [BR:spen03400]
    107011627
Enzymes [BR:spen01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     107011627
    6.5.1.6  DNA ligase (ATP or NAD+)
     107011627
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     107011627
DNA replication proteins [BR:spen03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    107011627
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     107011627
DNA repair and recombination proteins [BR:spen03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     107011627
   NER (nucleotide excision repair)
    Other NER factors
     107011627
   MMR (mismatch excision repair)
    Other MMR factors
     107011627
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C RMMBL Lactamase_B_2
Motif
Other DBs
NCBI-GeneID: 107011627
NCBI-ProteinID: XP_015066696
LinkDB All DBs
Position
2
AA seq 1441 aa AA seqDB search
MSSDAGTLTLDSTTLYITALNSLSDKSSSNSIPLSLPLPPIPSSIPQPKLIPRTRFIIDG
FKYAADFSVSYFLSHFHSDHYTGLSSNWSKGIIFCSSTTANLLIEVLNVPAQYVVSLPLS
EAVLIDGSEVFLIDANHCPGAVQFLFKVPVSDGKFERYVHTGDFRYCDDMKLEPVLNAFV
GADAVFLDTTYCHPKFIFPSQQESIDYIVGVIEKNGVENEGSLKNILFLIATYVIGKEKI
LMEVSRRCQRKIHVDGRKMSVLGVLGHGEDGVFTTVESETDVHVVGWNVLGETWPYFRPN
FEKMDKIMNEKGYSKVVGFVPTGWTYEVKRNKFSVRKKDSFEIHLVPYSEHSNYDELREY
VKFLKPKHVIPTVGTDVEKLDSKHANAMRKHFAGLVDQMAIKQEFLMRFHPSVQGKEDVD
TKESGLALVRITEQENTNRSTHTPVSIIKQENEDTSSDSKSCNAADMDTVIPSSFPQGES
VSPGLEKISEGDMEEILEELQGCLPTWVTKGQMLDLVGISDKNVVDAVSYFYEHETEYRE
QVTASNSVTSSLEANSANKSALPCKPCLGKSLQQDETAASSKTVKLPIMDSSCSKKVSPG
KRKRSTGNKSSSSSNKVSPGKRKRSTGNKSFEKAKGHTSMESGGPKQCTITKFFSKTLPL
PLQNRNSEADSKNFHDDSCMLPNASIEAYKEEADRFIQIMNGDDSLRSYATTVLAKTKGD
ISMALDIYFSEYKDVGETNGDGISKTNKLLQPQCAKEVYTSSKDDKLPKILGDVDANLSL
CGVPFADNAVNYVSLPHEKYSPVEHACWSKGQATPYIHLARTFELVKEEKGKIKATSMLC
NMFRSLLALSPEDVLPAVYLCTNKIAPDHENMELNIGGSTVVAALEEACGTKKSKVRELY
NSLGDLGDVAQLCRQTQSLLAPPVALTVRGVYSALRRISLQAGSGSAIRKKSLIVNLMCS
CREKEMKFLVRTLVRNLRIGAMMRTVLPALAQAVVFNSTPYEGLVENLKDCLQRLSAEVV
EAYNILPSLDVLVPSLMEKGIEFSSNTLSMAPGIPIKPMLAKITNGVPQVMKLFQNKAFT
CEYKYDGQRAQIHKLSDGSVRVFSRNGDETTARFPDLVNIITESCDSRGATFILDAEVVA
IDRQNGPKLMSFQELSSRERGSKDSIIALDKIKVEICIFVFDIMFANGEQLLNLPLRQRR
KYLKDLFGDGKVGYLEYATEMTVECDDACADDEATLARMNSFLNDALHASCEGIMVKSLD
EDAGYTPSKRSDAWLKVKRDYVEGLNDSLDLVPIGAWHGNGRKAGWYSPFLMACYNPDTE
EFQSVCRVMSGFSDSFYVEMRDFFDADKICQKKPPYYRSEEVPDMWFSPEVVWVIRGADF
TVSPVHHAAIGLVHPSRGISVRFPRFIRCLSDRKPEECSTSADIADMFRTQIRKMDVKVE
K
NT seq 4326 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccgacgccggaaccctaaccctagactcaaccactctgtacataaccgctctc
aactccctctctgataaatcctcatcaaattcaatcccattgtcccttcctctccctcca
atcccttcttcaatcccccaaccaaaactcatcccaagaactcgctttatcatcgacggt
tttaaatatgccgctgatttctccgtttcttacttcctctcccattttcactccgatcac
tatacaggcctctcctctaattggtctaaaggtatcatattctgttcctccaccactgct
aaccttctcatcgaggttctcaatgttcctgcgcaatatgtagtatctttaccgctctcc
gaagcggttttaatagacggttctgaagtttttctcatcgatgccaatcattgtcctggt
gctgtgcagttcttatttaaagttccagttagtgatggaaaatttgagcggtacgttcac
acaggtgattttcgttattgtgatgacatgaaattagagcctgtattgaatgcatttgtg
ggtgctgatgctgtatttttggatacaacttattgtcatccgaaatttatattccctagt
caacaggagtcaattgattatatagttggagttatagagaaaaatggagttgagaatgag
ggttcattgaaaaatatcttgtttcttattgctacttatgtcattgggaaagagaagatt
ttaatggaggtttcacggaggtgtcagagaaagatccatgttgatggacgaaaaatgtcg
gttttaggagtattaggtcatggggaggatggagtatttactaccgttgagtctgaaact
gatgttcatgttgttgggtggaatgtattgggtgagacttggccatatttcaggcctaat
tttgagaaaatggataagatcatgaatgagaaaggatattccaaggtggttggttttgtc
cccacaggttggacttatgaagtgaagcggaataagttttcagtgagaaagaaagattcc
tttgagatacatcttgttccatatagtgaacattcaaattatgatgagcttagagaatat
gtgaaatttttgaaaccaaagcatgtcatcccaacagtaggtacagatgttgagaagctg
gatagcaaacatgcaaatgccatgcggaagcattttgctggcttggttgatcagatggcc
atcaagcaagaatttctaatgcgttttcatccttctgtccaagggaaggaagatgtagat
acaaaagaatctggtcttgctttagttagaattacggagcaagaaaacacaaacagatct
actcatactccagtcagtatcatcaaacaagaaaatgaggatacttcatctgattctaaa
agctgcaatgctgctgatatggatactgttatcccttcctcatttcctcaaggagaatct
gtgtcgccaggtttagaaaaaataagtgaaggtgatatggaggaaatactagaagaactt
caaggctgtttgcccacttgggtaactaaaggtcagatgttggatttagttggtatttca
gataaaaatgttgttgatgcagtctcatacttttacgaacatgaaacagaatatcgtgaa
caggtcactgccagtaattctgttacctcttctttagaggcaaactcagcaaataagtct
gcattgccttgtaaaccatgtcttggtaaaagcctgcagcaagatgagacagctgcgtca
agtaaaactgttaaactacccatcatggacagttcctgtagcaaaaaagtttctcctggt
aaaaggaagagaagtactggaaacaagtccagttccagtagcaacaaagtttctcctggt
aaaaggaagagaagtactggaaacaagtcatttgagaaagcaaaaggacatacgagtatg
gaatctggtggaccaaagcaatgtactataacaaagttcttcagtaaaacgctgcctctt
cctttgcagaatcgaaacagtgaagccgatagtaaaaatttccatgatgatagttgcatg
ctaccaaatgcctctattgaggcttataaagaggaagctgatcggtttattcagattatg
aatggggatgactcattgagaagttatgctaccacagtactagcaaagactaaaggagac
ataagtatggcacttgatatttatttttcagaatacaaagatgtaggagagactaatgga
gatgggatttctaaaacaaacaaattgttgcaacctcagtgtgctaaagaggtttacact
tcttccaaagatgataaattacccaaaatattaggagatgttgatgccaatttgtcgttg
tgtggtgttccctttgctgataatgctgtaaattatgtatcacttccccatgagaaatac
tctcccgtggaacatgcttgctggagtaaggggcaggctactccatacatacatcttgca
cgaacttttgaattggtaaaggaagaaaaagggaagataaaagcaacgtcaatgttgtgc
aatatgtttcggagcttgctagctttgtctccggaggatgtgcttcctgctgtgtacttg
tgcacaaacaagatagcccctgaccatgaaaatatggaattgaacattgggggtagtact
gttgtagcagcactagaggaggcatgcgggacaaagaaatcaaaagtacgagaactatac
aacagcctcggtgatcttggtgatgttgctcaactttgccgacaaacacaatcattactt
gctcctccagtggcacttacagttaggggtgtatactctgctcttagaaggataagcttg
caagcaggtagtgggagtgccatccgaaagaaaagcctgattgtcaatctcatgtgttca
tgtagagagaaggagatgaagtttcttgtgagaacgttggttcggaatttgcgcattgga
gccatgatgagaactgttcttcctgcattagctcaagcagttgtgttcaattctactcct
tatgaaggactggtcgaaaacctgaaagattgtctgcagcgactttcagcagaagtagta
gaagcgtataacatccttcccagcttggatgtacttgttccttccttgatggagaagggg
attgagttttcttcaaatacattgtcaatggctccaggcatacccatcaaaccaatgctt
gcaaagattactaatggggtccctcaagtgatgaagctctttcagaacaaagcctttaca
tgtgaatacaaatatgatggtcagcgagctcagattcataaactgtctgatggttcagtc
cgtgtattttcaaggaatggggatgagacaacagctagatttccggatttggtaaatata
attacagaatcatgtgattccagaggagcaacatttatcttggatgcagaggttgttgca
attgataggcaaaatggtccaaagctcatgtcgttccaagaactatcttcacgtgagagg
gggtccaaagattccatcattgcgttagataaaattaaggttgagatatgcatttttgtt
ttcgatatcatgtttgcaaacggagaacaattgttgaatctgccgctccgtcaaaggcga
aaatatttgaaggatttatttggtgatggcaaagtaggttatttagagtacgcgacagaa
atgactgtagagtgcgatgatgcttgtgcagatgatgaagctacactggctaggatgaac
agctttcttaatgatgcactacatgcttcatgtgaagggatcatggtgaagtcccttgat
gaagatgctggatacacaccctcaaagcgctctgatgcatggttaaaggtcaagagagac
tatgttgaaggattaaatgattccctggacttggttccaattggtgcatggcatgggaat
ggaagaaaagcaggatggtatagtcctttccttatggcctgctacaaccctgacacggag
gaatttcagagtgtctgccgggtcatgtctgggttttctgattccttctatgtagagatg
agagacttcttcgatgcggacaagatctgccagaaaaagccaccctactaccgaagtgaa
gaggttccggatatgtggttttctccagaagttgtgtgggtgataaggggtgctgacttc
acagtgtcaccagtgcatcacgcagctattggtttagtccatccatcgcgtggtatttct
gtcagattccccaggttcatccggtgtttgtcagatagaaaacctgaggaatgtagcaca
tctgcagatatagctgacatgttccgcactcagattagaaaaatggatgtgaaggttgaa
aaatag

DBGET integrated database retrieval system