KEGG   Solanum pennellii: 107011951
Entry
107011951         CDS       T04130                                 

Definition
(RefSeq) probable DNA-3-methyladenine glycosylase 2
  KO
K01247  DNA-3-methyladenine glycosylase II [EC:3.2.2.21]
Organism
spen  Solanum pennellii
Pathway
spen03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    107011951
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spen03400]
    107011951
Enzymes [BR:spen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     107011951
DNA repair and recombination proteins [BR:spen03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     107011951
SSDB
Motif
Pfam: HhH-GPD
Other DBs
NCBI-GeneID: 107011951
NCBI-ProteinID: XP_015067130
LinkDB
Position
2
AA seq 353 aa
MSEQTQTPPQPLPTSSDSTLVSNSPVDLPPNPSNPSKIPIRPQKIRKLSSTPSSNGKTPE
TAVPSASSATSGAITVTKNRRKTAPKSSRVLPQIIKPLSADGEIDNALQHLRSVDPLLVS
LIDTLPSPQFELHHSAFLALSKSILYQQLAYKAGTSIYTRFVSLCGGEDAVCPDIVLALS
PQQLKQVGISGRKASYLHDLANKYKSGILSDETLVKMDDRSLFAMLSMVKGIGSWSVHMF
MIFSLHRPDILPVSDLGVRKGVQLLYGLEELPRPSQMEQLCDKWKPYRSAGAWYMWRLVE
GKGTPTIAAAPIDGGNVQALQQFPVEQETQQHQLQLLEPINGIENLGACIWSQ
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgagtgaacagacgcaaactccacctcaacctctacccacttcttctgattccaccctt
gtatcgaactctccagttgatcttccaccaaacccctctaacccttccaaaatcccaatt
cgaccacagaaaatccgaaaactctcttccaccccatcctccaatgggaaaaccccggaa
accgccgtaccatcagcatccagtgcaaccagcggagcgattaccgtaacgaagaatcgt
cggaagactgcaccgaaatcatcaagggttttgccccaaatcatcaaacccttatcagct
gatggagagattgacaatgcactgcagcatctacgttctgtggaccctcttcttgtttcc
ttaatcgatacacttccttccccgcaatttgagttgcaccattctgcgtttttagctctt
agcaagagcattctttatcagcaactagcttataaagcaggcacctcaatctacactcgc
tttgtgtccctttgtggaggagaggacgctgtttgccctgacattgtcctcgctctatct
cctcaacagctcaagcaagtaggaatctcagggcggaaggctagttatctccatgacttg
gcaaacaagtataaaagtgggattttgtctgatgaaactcttgtaaagatggatgatagg
tcattgtttgccatgctttcaatggtgaagggtattggttcttggtcagtgcatatgttc
atgatcttttcacttcatagaccagatattttgcctgttagtgacttgggggtcaggaaa
ggtgtgcaattgctgtatggactggaggaactgccaaggccgtcgcagatggagcaatta
tgtgacaaatggaagccatatagatctgcaggggcatggtatatgtggcggttagtggaa
gggaaagggactccaactattgcagcagcaccaattgatggtggtaatgtgcaggcattg
cagcaatttccggtggaacaggagacacagcaacatcaactgcagcttctcgagccaatt
aatggcatcgaaaatcttggggcttgcatttggagccaatga

KEGG   Solanum pennellii: 107015801
Entry
107015801         CDS       T04130                                 

Definition
(RefSeq) DNA-3-methyladenine glycosylase 1 isoform X1
  KO
K01247  DNA-3-methyladenine glycosylase II [EC:3.2.2.21]
Organism
spen  Solanum pennellii
Pathway
spen03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    107015801
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spen03400]
    107015801
Enzymes [BR:spen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     107015801
DNA repair and recombination proteins [BR:spen03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     107015801
SSDB
Motif
Pfam: HhH-GPD
Other DBs
NCBI-GeneID: 107015801
NCBI-ProteinID: XP_015071700
LinkDB
Position
4
AA seq 332 aa
MAGESESAAEPNPNTLTPSNPPSTDAINIVPLQTHSPPTKLPSRPRKTRKLSNTVDPSLP
KTQISTIVPRIVSRSLSYEGELESAINYLKSSDPLLSPLIETYPPPTLELFQPPFLALTK
SILFQQLAYKAGSSIYTRFISLCGGESNVVPDMVLGLTPQQLRQIGVSARKASYLHDLAR
KYQNGILSDKSIVDMDDKSLFTMLTMVNGIGSWSVHMFMIFSLHRPDVLPIHDLGIRKGV
RMLYGLEDLPRPSQMDQLCEKWKPYRSVASWYIWRFVEAKGANSKGNVVGNSDVSLQQQM
LSMQQQQQQQHQQFLDPINGILNVGACAWDSN
NT seq 999 nt   +upstreamnt  +downstreamnt
atggctggagaatcagaatctgctgctgaacctaaccctaacaccctcaccccatcgaat
cccccttctaccgacgccattaatattgtacctcttcaaactcattcaccacccaccaag
ctaccttctcgacccagaaaaactcggaagctttccaatactgttgatccctctttaccc
aaaacacagatttccaccatcgtaccaagaattgtttctcgttcactttcatacgaaggt
gagctcgaatccgccattaattacctcaaatcctctgacccgttactctctccattaatt
gaaacatacccacctcccacactcgaactttttcaacccccttttcttgctttaacaaaa
agcattctgtttcagcagctagcgtataaagccgggtcatcgatttacactcgatttata
tctctttgtggtggggaatcgaatgtggtgccagatatggttttgggattaaccccacaa
cagcttcgtcaaattggggtttctgctagaaaagcaagctatttacatgacctagcaagg
aagtatcaaaatgggattttgtccgataagtcgattgtggatatggatgataaatcgctt
tttacaatgcttactatggtgaatggaattgggtcttggtcagttcatatgtttatgatt
ttttcacttcatagaccggatgtgttgccgatacatgatcttggtattaggaaaggggtg
agaatgttatatggtcttgaggatcttcctaggccatcacaaatggatcagttgtgtgag
aaatggaagccttataggtcggtagcttcgtggtatatttggaggtttgtagaggcaaag
ggagcgaattcgaaaggcaatgtggtggggaattctgatgttagtttacagcagcagatg
ttgtcaatgcagcagcagcaacaacaacaacaccagcagttcttggatcctattaatggg
attcttaatgttggggcatgtgcatgggacagtaattga

DBGET integrated database retrieval system