KEGG   Solanum pennellii: 107012202
Entry
107012202         CDS       T04130                                 

Definition
(RefSeq) uncharacterized protein LOC107012202 isoform X1
  KO
K10773  endonuclease III [EC:4.2.99.18]
Organism
spen  Solanum pennellii
Pathway
spen03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    107012202
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spen03400]
    107012202
Enzymes [BR:spen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     107012202
DNA repair and recombination proteins [BR:spen03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     107012202
 Prokaryotic type
     107012202
SSDB
Motif
Pfam: HhH-GPD zf-C2H2_6 zf-C2H2_4
Other DBs
NCBI-GeneID: 107012202
NCBI-ProteinID: XP_015067463
LinkDB
Position
3
AA seq 506 aa
MTKLTKTRKTPKRKKTDGRCSPFPCPPSKSSRKANVTAGSSNDSEPFPDYSQPTPEECRA
VRDDLLALHGFPKEFIKYRKQRSLDHIEYEEDDISGAEPCKESVLDGLINTILSQNTTEA
NSQKAFASLISSFPTWECVLAADAKLVEDTIRCGGLAPTKTSCIKGILSSLLQKKGNLCL
EYLRELSIEEIKRELSCFRGIGPKTVACVLMFQLQRDDFPVDTHIFQIAKTLHWVPAAAD
VKKTYIHLNRRIPDELKFDLNCLIYTHAFQTIWHARMDEALYQKSTYLNLLSTGLNGTDN
VCCKTTTSDKKLRIFGFEVSPCSNDIICSKSESDESISSSETFADGRLVEKTSISMSSSS
IVLPNPNENLRNLSSSVVSKFKYECHFCLKKFANSRALGGHQNAHRKERLKKKRMDLEAK
RASSMLHFFSLIRNAGVIYPYYSLSHQNLFVSGSSTINFSSVYHCQNGTHPLYVAVDAHP
QGELQLQNNCSTLLQGGESRKRDLLS
NT seq 1521 nt   +upstreamnt  +downstreamnt
atgaccaaactgacaaagacgcgaaaaaccccaaagaggaaaaaaaccgacggccgttgt
tctccttttccatgtccaccatccaaatcgtcgagaaaggcaaatgtcaccgctggttcc
tccaatgactctgagccattccccgattattctcaacccacgccggaggaatgccgagcc
gtacgggatgatcttttggctctccatggtttccccaaagaattcattaagtaccgcaag
caaagatcactcgatcacattgaatacgaagaagatgatattagtggtgctgagccttgt
aaagagagtgtactggacggtctgataaacacaattttgtcccagaacaccaccgaagct
aactctcagaaggcttttgcttccctcatatcctctttcccaacctgggaatgtgttcta
gctgctgatgcaaaacttgttgaagataccataagatgtggaggtttagcacccaccaaa
acttcttgtatcaagggaatattaagttcattgttacagaaaaaaggaaacctgtgcttg
gagtatttgagagagctatctatagaggaaatcaaaagggagctctcttgtttcagagga
attggtcccaaaacggtggcatgtgtcttgatgttccaacttcagcgagatgattttccg
gtggatacacacatttttcagattgcaaagactcttcattgggtacctgctgcagctgat
gtgaaaaagacatatattcatctgaatcgacgaattccagatgaactaaagtttgaccta
aattgtctcatatatacccatgcatttcaaaccatttggcatgccaggatggatgaggca
ctgtaccaaaaatctacctacttaaatctcctttcaactggactaaatggaacagataat
gtctgttgcaaaactactacttcagataaaaagcttagaatttttggctttgaggtaagt
ccttgttcaaatgatatcatttgttcaaaatctgaaagtgatgagagtattagctcctct
gaaacatttgcagatggaagactagtggaaaaaacatccatctctatgagttcctctagc
atagtccttccgaacccaaatgaaaacctcagaaacttgagctcctcagttgtcagtaag
tttaaatacgagtgccacttctgtttaaagaagtttgcaaactcacgggcactgggaggt
catcagaatgcccatcgaaaagagaggctgaagaagaaaagaatggatcttgaagcaaag
agagctagctccatgctccattttttctctttaatcagaaacgctggagttatctaccct
tactattctctaagtcatcaaaacctctttgtttctggaagttcaaccatcaatttcagc
tccgtatatcactgtcagaatggtacacatcccctatatgttgctgttgatgctcatccc
caaggtgaactacaattgcagaataactgttctaccttgttgcagggtggtgagtccaga
aaaagagacctgttgtcatga

KEGG   Solanum pennellii: 107021495
Entry
107021495         CDS       T04130                                 

Definition
(RefSeq) endonuclease III homolog 1, chloroplastic-like
  KO
K10773  endonuclease III [EC:4.2.99.18]
Organism
spen  Solanum pennellii
Pathway
spen03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    107021495
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spen03400]
    107021495
Enzymes [BR:spen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     107021495
DNA repair and recombination proteins [BR:spen03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     107021495
 Prokaryotic type
     107021495
SSDB
Motif
Pfam: HhH-GPD HHH DUF2028
Other DBs
NCBI-GeneID: 107021495
NCBI-ProteinID: XP_015077657
LinkDB
Position
6
AA seq 378 aa
MSVSLLRNTAFLPSISLGIQTTFSAKMRRTRSSLNQETPSQKNPGCDGTGGSSVPELRVF
IRRKRVKKTVEVIAKEVKEESSGKKLVRLPDIEDFSYSKDITHPQSTPSKTVRLTGEKTL
PQLMQTEIRGFSLSDPLQPPSNWEKVLEGIRKMRSAEDAPVDSMGCEKAGSSLPAKERRF
AVLVSSLLSSQTKDQVNHGAVQRLLQNGLLAADAIDSANEETIKSLIYPVGFYTRKASNL
KKVAKICLSKYNGDIPSSLEELLLLPGIGPKMAHLVMNVAWENVQGICVDTHVHRISNRL
GWVSRPGTKQKTRTPEETRESLQLWLPKEEWVPINPLLVGFGQTICIPLRPRCAICTVSD
LCPSAFKEAASPSSTPKK
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgtctgtctctcttctgagaaacactgcgtttcttccctcaatctcacttggaattcaa
accactttctccgccaaaatgcgaagaacacgtagctccctcaaccaagaaaccccttct
cagaaaaacccaggttgtgatggcacaggtggaagctccgttcctgaacttcgtgttttc
atccgaagaaagagagttaaaaagactgtggaagtcatagccaaagaggtcaaggaagaa
tcttctggcaaaaaacttgttagactgcctgatatagaggatttttcctattcgaaggac
attacacacccccagtcaacaccttccaaaactgtgcgtttgacaggagaaaaaactcta
ccccagttgatgcaaacagaaattagaggcttcagtctatctgatccactacaaccaccg
tcgaactgggaaaaagtccttgaagggatccgcaagatgagatctgcagaagatgcacct
gtagactccatgggttgtgagaaagctgggagttcacttcctgccaaggaaagaagattt
gcagtccttgtatcatcactcttgtcaagccagaccaaagatcaagttaatcatggagct
gtccagcgtctccttcaaaatggcttgcttgctgcagatgccattgactcagccaatgaa
gaaacaatcaagagtttgatatatccagtggggttttacacacgaaaagctagcaacctg
aaaaaagttgcaaaaatttgtctatcaaaatacaatggggacatccctagttcattggaa
gaattgcttctgctcccaggaattggtcccaagatggctcacctagttatgaatgttgca
tgggaaaacgtccaagggatatgtgtagatactcatgtgcatcgtatttctaatcggctt
ggatgggtatcacgtcctggaactaagcagaaaacgagaacccctgaggagactagggag
tccttgcaactttggcttccaaaggaagaatgggtaccaatcaatcctctcttggttggg
tttggtcagaccatttgtatacctttgagaccacgttgtgcaatctgtacagtaagtgat
ctctgcccatcagcattcaaagaggcagcaagcccatcgtccacacccaagaagtga

KEGG   Solanum pennellii: 107029184
Entry
107029184         CDS       T04130                                 

Definition
(RefSeq) endonuclease III homolog 1, chloroplastic-like isoform X1
  KO
K10773  endonuclease III [EC:4.2.99.18]
Organism
spen  Solanum pennellii
Pathway
spen03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    107029184
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spen03400]
    107029184
Enzymes [BR:spen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     107029184
DNA repair and recombination proteins [BR:spen03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     107029184
 Prokaryotic type
     107029184
SSDB
Motif
Pfam: HhH-GPD HHH
Other DBs
NCBI-GeneID: 107029184
NCBI-ProteinID: XP_015086020
LinkDB
Position
9
AA seq 341 aa
MSLSLLRNTANLSSLPFPVRFISFTAMSKARKIPLLQTPGSEDDGVAPKNRVRKRRVEMI
AKEVKIESPDKKFLRHPEIEDFASDNVYSQSIQPPANWESIMEGIRSMRLSEHAPVDSID
PDEGVTSLQPKERRFAVLVGSLLSSQTKGHVTHEANQRLLENGLLSADTMDRADEATIKS
LIYPVGFYTRKAQHLKQVAKVCVSKYDGDIPSTVDDLLLLPGVGPKIAHLVMIMAWNKVE
GICVDTHVHRVSNRLGWVSRPGSKQGTRSPEETRVSLQQWLPREEWVSINLLLVGFGQTI
CTPLRPRCAKCTIREFCPSAFKEISTPASTSKTRRPKKELG
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgtccctctctcttctccgaaacactgcaaatctctcttcacttccattcccagttcga
ttcatctccttcacagcaatgtcaaaagcacgaaaaattcctcttttgcaaaccccagga
tctgaagatgatggagttgctcctaagaacagagtgagaaaaaggagagtggaaatgata
gctaaagaggtgaaaatagaatctccagataaaaaatttctcaggcatccagaaattgaa
gattttgcaagtgacaatgtttattctcagtcaatacaacctcctgccaactgggaaagc
atcatggaaggtatacgcagcatgagattatcagaacatgcacctgtggactccattgac
ccagatgaaggggtgacttctcttcaacctaaggaaagaagatttgctgttctggttggt
tcattgttatcaagccagaccaagggtcatgttactcatgaagcgaatcaacggctcctc
gaaaatggtttgctgagtgctgacacaatggatagagctgatgaagccaccataaagagc
ttgatatacccggttggattttacacaagaaaggctcagcaccttaaacaagttgcaaag
gtttgtgtctctaaatatgatggagacattcctagtacagtggacgacttgcttctactt
ccaggtgttggtcccaagatagctcacctggttatgattatggcatggaacaaagttgaa
gggatttgtgtagatacgcacgtgcatcgcgttagcaatcgacttggttgggtctcgcgg
cctggatcaaagcagggaactagatcccccgaagagacaagggtctcgttgcagcagtgg
cttcctagagaagaatgggtttccattaatttacttttggtaggctttggacagaccata
tgtactcctctgagacctcggtgtgcaaaatgtacgataagagaattctgcccatcggca
tttaaggagatatcaacccctgcttccacttccaaaacacgacgccccaagaaagaactg
ggatga

DBGET integrated database retrieval system