KEGG   Solanum pennellii: 107012604
Entry
107012604         CDS       T04130                                 

Definition
(RefSeq) DNA-(apurinic or apyrimidinic site) lyase 2
  KO
K10772  AP endonuclease 2 [EC:4.2.99.18]
Organism
spen  Solanum pennellii
Pathway
spen03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    107012604
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spen03400]
    107012604
Enzymes [BR:spen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     107012604
DNA repair and recombination proteins [BR:spen03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     107012604
SSDB
Motif
Pfam: Exo_endo_phos zf-GRF
Other DBs
NCBI-GeneID: 107012604
NCBI-ProteinID: XP_015067967
LinkDB
Position
3
AA seq 588 aa
MKIVTYNVNGLRPRIQQYGSLLKLLDSLDADIICLQETKLSKNDIRADLVRAEGYESFFS
CCTRTSDRGRSSGYSGVATFCRVKSAFMSNEVALPISAEEGFTGLLATSKGYEPRKEECA
SIAEGLECFTRDELLKVDSEGRCLITDHGHFVLFNLYGPRAVQDDSERIQFKLTFFKMLE
RRWECLMHQGRRIVIVGDLNIAPAAIDRCDAEPDFEKNVFRQWFRSLLVQNGGRLLDIFR
AKHPDRKGAYTCWSQSTGAEEFNYGSRIDHILSATSCLHGEEIQEGHDFVTCNVAECDIL
MKFQRWKPGNTPRWKGGRSIKLEGSDHVPVYMSLVEIPEVLQHSTPPLSTRYHPQVFGSQ
TLVSMFTRRQTTEQVTSEESESPHIPSQEDFLSTPETYDSRAAQISVLGSQSNSNILPCI
ATKKKARLGQGSQLTLNSFFQKHTHRSETSSSSFADSKLCQTDISYSRIEPDGVPSPADE
SGASKDCRSSAIDSNQHKCQLDACDSDKEKRKVALQEWQRIQQLMQNSVPLCKGHQEPCV
PRVVKKAGPNLGRRFYACARAEGPSSNPEANCGYFKWAAVLKSKGRGK
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgaagatagtgacgtacaacgtgaacggtttaaggccacgcatacagcaatacggttca
cttctcaaattgttggattcgcttgatgctgatattatctgtttacaggagactaaattg
tcgaagaatgatattcgagccgatttggttcgtgctgagggttatgagtctttcttctct
tgttgcactcgtacttctgatcgtggacgctcttctggatattccggtgttgctaccttt
tgtcgtgtaaaatctgcattcatgagcaatgaagtagctctgccgatttctgcagaagaa
ggcttcactggtctcctcgcaacatctaaaggatatgaacctagaaaggaggagtgcgct
tcaatagcagaaggcctcgagtgttttactagagatgagcttcttaaagttgatagtgag
ggacgttgtctgatcactgatcatggtcattttgttctattcaatttatatgggcccaga
gctgttcaagatgactctgaaagaatccaatttaagctcacattttttaagatgttagag
agaagatgggaatgcctgatgcatcaaggaaggaggattgttattgtaggtgacctcaat
attgctcctgctgccatagatcggtgcgacgcagaacctgattttgagaagaacgtgttc
agacaatggtttagatcattgctagtgcaaaacggagggcgtctccttgatatttttaga
gcaaagcatcctgataggaaaggagcctatacttgctggtcacagagtacaggagccgag
gaatttaattatggttctaggattgatcacatacttagtgccacatcatgcttgcatggt
gaggaaattcaggaaggacatgactttgttacttgcaatgttgcagagtgtgacatattg
atgaaatttcaaaggtggaaacctggaaatacgccaaggtggaaaggagggaggagcatc
aaattagaaggttctgatcatgttccagtttacatgagtttagtagaaattcctgaagta
ttgcagcatagcaccccgccattatctaccagatatcatccccaggtctttgggagtcaa
actcttgtgtcaatgttcacgagaaggcaaacaactgagcaagttacttcagaggaaagt
gaaagccctcacattccaagtcaggaagactttctttcaactccagagacttatgatagt
agagctgcgcagatttcggtgcttggctctcaaagcaactctaatattcttccctgcatt
gcgaccaagaagaaagcgaggcttggtcaggggtctcagctcacacttaactcattcttc
cagaaacacacacatagaagtgagacttctagcagcagctttgctgattctaaactttgt
cagacagacatctcttactctcggattgagcctgatggagtgccttctcctgctgatgaa
agtggcgcttcaaaggactgcagatcaagtgcaattgacagtaatcaacataagtgccag
ctagatgcatgcgactcagataaagagaagaggaaagtggcattacaggagtggcaaagg
attcagcaattgatgcagaatagtgtacctctttgtaagggccatcaagaaccttgtgtt
cctcgggtcgttaaaaaagcagggcccaatttgggccgcagattttatgcttgtgctcga
gctgagggaccttcatcaaatcctgaagcaaactgtggttacttcaaatgggctgctgtt
ctaaaatccaagggaagaggaaaatga

DBGET integrated database retrieval system