KEGG   Solanum pennellii: 107013022Help
Entry
107013022         CDS       T04130                                 

Definition
(RefSeq) alpha-amylase-like
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
spen  Solanum pennellii
Pathway
spen00500  Starch and sucrose metabolism
spen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spen00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    107013022
Enzymes [BR:spen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     107013022
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-GeneID: 107013022
NCBI-ProteinID: XP_015068490
LinkDB All DBs
Position
3
AA seq 453 aa AA seqDB search
MFANLLLPKMNSLFPLCLIFSFILPMFASSTVLFQGFNWESSNKQSGWYNSLINLVPDLA
HAGVTHVWLPPPSHSVSPQGYMPGRLYDLDASKFGNQQELKTLIKALRDYGIKSVADIVI
NHRCADKKDSRGIYCIFEGGTTDDRLDWGPSFICKDDIQYSDGTGNLDTGLDFEPAPDID
HLNIRVQKELSDWMNWLKSEIGFDDWRFDFVRGYAPNITKIYMGNTSPDFAVGEFWNSLA
YAHDGKPDYNQDNHRNELVGWVQNGGGAVTAFDFTTKGILQAAVEGELWRLKDSNGKPPG
MIGVLPQNAVTFIDNHDTGSTQNMWPFPSNKVMQGYAYILTHPGIPSVFYDHFFDWGLKD
GISALISIRKRNGICATSNVQIMASDSDLYIAMIDQKIIVKIGPKLDLGNLIPPSYQVAT
SGQDYAVWEQKAFIYHTKCHHVQNGSQCLMSFD
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcaaaccttttgctcccaaaaatgaattcccttttccctctttgtttaattttc
tctttcattcttcctatgtttgcttcttccacggtgttgtttcaggggttcaattgggaa
tcgagtaataagcaaagtggttggtacaattctctcatcaatttagttccagacttggct
catgctggagttactcatgtttggttaccaccaccatctcactctgtttcccctcaaggt
tatatgccaggaagattgtatgacttggatgcttccaagtttgggaatcagcaagaactg
aaaactcttattaaggctttacgtgactatgggatcaaatcggttgctgatatagtaata
aatcatcgatgtgctgataaaaaagatagcaggggaatatactgcatctttgaaggagga
acaacagatgaccggcttgattggggtccgtctttcatttgcaaggacgacatacaatat
tctgatggcacggggaatctagacacgggtttggactttgaacctgcccctgatatcgat
catcttaatatcagagtgcagaaagagttatcagattggatgaattggctcaagtctgaa
attggatttgatgactggcgtttcgattttgttaggggatatgcacctaacatcaccaag
atttacatgggaaacacgtccccggattttgcagttggtgaattttggaactctcttgca
tatgcacatgacgggaaaccggactataaccaggacaatcataggaatgagctagttggt
tgggttcaaaatgggggtggggctgtaacagcctttgatttcacaactaagggaattctt
caagctgcagttgaaggagagttatggagattgaaagattccaatggaaaacctcctggg
atgataggtgttttgcctcaaaatgctgtgacttttatcgataatcatgatactggatcg
acacaaaatatgtggccattcccttcaaacaaagttatgcaaggatatgcatacattctc
actcatccaggaattccatcagtgttttatgaccatttctttgattggggcttgaaggat
ggaatttcagcactaatttctattaggaagaggaatgggatttgtgcaacaagcaatgtg
cagataatggcttctgattctgatctttatatagcaatgattgatcagaaaattattgtc
aaaattgggccaaaacttgatcttggaaatcttatcccacctagttatcaggtggcaact
tctggacaagattatgctgtatgggagcaaaaggcattcatttaccatactaaatgtcac
catgtacaaaatggttctcagtgtttaatgtcatttgactga

DBGET integrated database retrieval system