KEGG   Solanum pennellii: 107014538Help
Entry
107014538         CDS       T04130                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
spen  Solanum pennellii
Pathway
spen00010  Glycolysis / Gluconeogenesis
spen00053  Ascorbate and aldarate metabolism
spen00071  Fatty acid degradation
spen00280  Valine, leucine and isoleucine degradation
spen00310  Lysine degradation
spen00330  Arginine and proline metabolism
spen00340  Histidine metabolism
spen00380  Tryptophan metabolism
spen00410  beta-Alanine metabolism
spen00561  Glycerolipid metabolism
spen00620  Pyruvate metabolism
spen01100  Metabolic pathways
spen01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spen00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107014538
   00053 Ascorbate and aldarate metabolism
    107014538
   00620 Pyruvate metabolism
    107014538
  Lipid metabolism
   00071 Fatty acid degradation
    107014538
   00561 Glycerolipid metabolism
    107014538
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    107014538
   00310 Lysine degradation
    107014538
   00330 Arginine and proline metabolism
    107014538
   00340 Histidine metabolism
    107014538
   00380 Tryptophan metabolism
    107014538
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107014538
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    107014538
Enzymes [BR:spen01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     107014538
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 107014538
NCBI-ProteinID: XP_015069965
LinkDB All DBs
Position
3
AA seq 535 aa AA seqDB search
MAARRLSSLLSRSLHLPSVSASLGRSHGVGRHINRFSTAAAVEEIITPPVQINHTKLLID
GQFVDSASGKTFPTLDPRTGEVIANVAEGDLEDVNRAVAAARKAFDEGPWPKMSAYERSR
IMLKFADLVEKHNDEIAALETWDNGKPYLQAAQAEVPSFVRLFRYYAGWADKIHGLTVPA
DGPHHVQILHEPIGVAGQIIPWNFPLLMMAWKVGPALACGNTIVLKTAEQTPLTALYVAN
LFHEAGLPPGVLNIVSGFGPTAGAALASHMDVDKLAFTGSTETGQTVLQLAAKSNLKPVT
LELGGKSPFIICEDADIDHAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFVEKAKARA
MRRVVGDPFKKGVEQGPQIDSEQFQKILRYIREGRDSSATLECGGDRIGSKGYFIQPTVF
SNVKEDMSIAQDEIFGPVQCVFKFKDIGEVIKRANNTRYGLAAGVFTKNINTANTLTRGL
RAGTVWINCYDIFDAGIPFGGYKMSGMGREKGIYSLNNYLQVKAVVTPLKNPAWI
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcgcagactttcttctttgctctctcgttctctccaccttccttctgtttct
gcttctctaggaagaagccatggtgtgggaaggcacatcaacaggtttagtacagctgca
gctgttgaggaaataatcactccacctgtccaaattaatcacaccaagcttctgatcgat
ggacaatttgttgattctgcatctggaaaaacattcccaactttggatccaagaactggg
gaagtcattgcaaatgttgctgaaggtgatctcgaagatgttaatcgcgctgtggctgct
gctcgcaaggcatttgatgaggggccatggcccaaaatgagtgcttatgaaaggtcacgg
ataatgctaaagtttgctgatttggtggagaaacacaatgatgagattgcagctttagaa
acatgggataatggcaagccatatttgcaggctgcccaagctgaagtaccttcttttgtg
cgattatttcggtattatgccggatgggcggataaaatccatggtctaactgttccagct
gatgggccacaccatgtacaaattttacatgaaccaattggggttgctggtcaaataatt
ccgtggaactttccccttcttatgatggcctggaaagttgggcctgctttagcatgcggt
aacactattgtcctgaagactgcagagcaaactccactgactgctctttatgttgcaaac
ttattccatgaggctggtcttcctccaggtgttttaaatattgtttctggttttggacct
accgctggtgctgcactggctagtcatatggatgtagacaagcttgctttcactggatca
acggaaactggacaaacagttcttcaactggctgccaaaagcaatctgaaaccagttacc
ctcgaactaggagggaaatcacctttcattatatgtgaggatgctgacattgatcatgct
gttgagctagcacattttgcactcttctttaatcagggccaatgttgttgtgctggttct
cgtacatatgtacatgaacgagtatatgatgaatttgtagagaaggcaaaggcacgtgca
atgagacgtgtagttggcgatcccttcaagaaaggtgttgaacaaggtcctcagatcgac
tcggagcaatttcagaagattcttaggtacataagagaaggccgtgacagctctgccacc
cttgaatgtggtggtgatagaattggctctaaaggctactttattcagcccacagtgttc
tcaaatgtcaaggaggacatgtcgatagcacaggatgagatttttggtccagtgcaatgt
gtcttcaaattcaaggatattggcgaagtaataaagagagcaaacaacactcgctatggt
ctagcagcaggagttttcacaaagaacatcaacacagcaaacaccttgacccgaggattg
agagctggaacggtgtggattaactgctacgatatatttgatgctggaattccttttgga
gggtacaagatgagtggcatgggcagggaaaagggtatttacagccttaacaactactta
caagtgaaggctgttgttactccattgaagaatccagcttggatatag

DBGET integrated database retrieval system