KEGG   Solanum pennellii: 107014676Help
Entry
107014676         CDS       T04130                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
spen  Solanum pennellii
Pathway
spen00010  Glycolysis / Gluconeogenesis
spen00051  Fructose and mannose metabolism
spen00052  Galactose metabolism
spen00500  Starch and sucrose metabolism
spen00520  Amino sugar and nucleotide sugar metabolism
spen01100  Metabolic pathways
spen01110  Biosynthesis of secondary metabolites
spen01200  Carbon metabolism
Module
spen_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
spen_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107014676
   00051 Fructose and mannose metabolism
    107014676
   00052 Galactose metabolism
    107014676
   00500 Starch and sucrose metabolism
    107014676
   00520 Amino sugar and nucleotide sugar metabolism
    107014676
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    107014676
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spen04131]
    107014676
Enzymes [BR:spen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     107014676
Membrane trafficking [BR:spen04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    107014676
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 107014676
NCBI-ProteinID: XP_015070184
LinkDB All DBs
Position
3
AA seq 498 aa AA seqDB search
MKKVTVGVAVVGAAAVCAVAVLIVNHRMRKSSKWGRAMAILREFEEKCKTQDAKLKQVAD
AMTVEMHAGLASEGGSKLKMLITYVDNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGG
IIHQEFAEASIPPSLMVGTSDELFDYIAAELAKFVAAEEEKFHQPPGKQRELGFTFSFPV
MQTSINSGNIMRWTKGFSIDDAVGQDVVGELTKAMKRKGVDMRVSALVNDTVGTLAGGKY
TQKDVAVAVILGTGTNAAYVERVQAIPKWHGPVPKSGEMVINMEWGNFRSSHLPLTEYDH
ALDNESLNPGEQIFEKMTSGMYLGEILRRVLLRVAEEAGVFGDEVPPKLKEPFVLRTPDM
SAMHHDTSSDLKVVGEKLKDILEISNTSLKTRKLVVELCNIVATRGARLAAAGVLGILKK
MGRDTPKQGGSERTVIAMDGGLYEHYTEYRMCLENSLKDLLGEELATSIVFVHSNDGSGI
GAALLAASHSMYLEDQDA
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagtgacggtgggagtcgcggtggttggtgcagctgcggtgtgtgcagtggcg
gtgttaatagtgaatcaccggatgcggaaatctagtaaatggggtcgtgctatggctatt
cttcgtgaatttgaagaaaagtgtaagactcaagatgcaaagcttaagcaagttgctgat
gctatgactgttgagatgcacgccggacttgcttctgaaggcggcagtaagctcaagatg
cttatcacttatgttgataatctacccactggtgatgaagctggcgtcttctatgcgttg
gatcttggtggaacaaattttcgagtattgcgagtgcaattgggtggaaaagatggtggt
attattcatcaagaatttgctgaggcatcaattcctccaagtttgatggttgggacttca
gatgaactttttgattatattgcggctgagcttgcaaaatttgttgctgcggaagaggaa
aaatttcatcaacctcctggtaagcagagagaactaggtttcaccttctcattcccagta
atgcagacttcaatcaactccgggaatattatgcggtggacaaaaggcttctctattgat
gatgcggttggtcaagatgttgttggagaactcacaaaagctatgaaaagaaaaggtgtc
gatatgcgtgtctcagctctggtgaatgataccgttggaacgttagctggtggtaaatat
acgcaaaaggatgtagctgttgctgttatcttaggtacagggaccaatgcagcttatgtg
gaacgggtgcaggcaattccaaagtggcatggtcctgtgccaaaatctggtgaaatggtt
atcaatatggaatggggtaattttaggtcatcccatctgcccttgacagagtatgatcat
gcattggataatgagagtttaaatcctggtgaacagatatttgagaagatgacttctggc
atgtacttgggagaaattttacgcagagttctactcagggtggctgaagaagctggcgtt
tttggtgatgaggtccctccaaagctcaaggaaccatttgtgttaaggacacctgatatg
tctgctatgcatcatgacacatcctctgatctgaaagtggttggtgaaaagctgaaggat
attttagagatatctaatacctccttgaagacgaggaaattagtggttgagctgtgcaat
atcgttgcaacacgtggggcaagacttgcagctgcaggtgtattgggcatcttgaaaaag
atgggaagagatacgcctaagcagggtggttcagaaaggacggttatagccatggatggc
gggttgtatgagcactatacagaatacaggatgtgtttagagaactctttgaaggacttg
ctcggagaggagttagcaacgagcatcgtttttgtgcactccaatgatggttctggcatt
ggtgctgctcttcttgctgcctctcattcaatgtaccttgaagatcaagatgcttag

DBGET integrated database retrieval system