KEGG   Solanum pennellii: 107014997Help
Entry
107014997         CDS       T04130                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
spen  Solanum pennellii
Pathway
spen00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:spen00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107014997
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spen03036]
    107014997
Enzymes [BR:spen01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107014997
Chromosome and associated proteins [BR:spen03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107014997
   Polycomb group proteins
    PRC2-EZH2 complex
     107014997
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
NCBI-GeneID: 107014997
NCBI-ProteinID: XP_015070626
LinkDB All DBs
Position
3
AA seq 922 aa AA seqDB search
MSPASDNSLSDSQTQRLNDLSIVSPEEATVEPDEVLSVIESLKRKIASERADYIKKRVEG
NTQKLENLTKDLYNLATERKCLEIFDAGGKNDLLSKRQKDALDMQNGIDTSNGDDDSNSS
EDDGYATSAILLGSSIAVKNAVRPIKLPEVKRIPPYTSWIFLDRNQRMTEDQSVVGRRRI
YYDQNGGETLICSDSDEEVLEEEEEKKVFAESEDYMLRMTIKEVGLSDIVLGLLGQCLSR
KPSEVKARYEALVKADDAGTSKNEFTESSLDLYLAKDLDAALDSFDNLFCRRCLVFDCRL
HGCSQDLIFPAEKQSPWYCSNADMEPCGPNCFSLAKKFESNATVISPQCASHGEKSILPS
DVANNTQMPGRKHVSRRSKSSKGEGAPNAKNISESSDSDIRPVNDITSNERSSSPSKSKS
DNKDGSNKRNSKRIAEHVLVAIKKRQKKMAVLESDTVASESLGFKDLNLHSISRKENEDA
SPSSQKAQCHSTKRSRRKNSPVLDSKNSLQGKAFGCKVMEVNSEKPVANCDDTLGKNEKV
GENNCKQEVDGTKSWRPIEKALFEKGLEMFGRSSCLIARNLMNGLKTCWEVFQYMNNSGN
KLFSGTGDGMDGILEGGCNGDGQEIMGNEPRRRSRFLRRRGRVRRLKYTWKSTGYHAIRK
RISERKDQPCRQFNPCGCQGPCGKECPCIVNGTCCEKYCGCPKGCKNRFRGCHCAKSQCR
SRQCPCFAAGRECDPDVCRNCWISCGDGTLGVPPQRGDSHECRNMKLLLKQQQKVLLGRS
DVSGWGAFLKNTVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAHR
KGDKLKFANHSPVPNCYAKVMMVAGDHRVGIFANERICAGEELFYDYRYEPDSAPAWARK
PEASGTRKEDAAPSSGRARKHT
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccggcgtcggataactccctgtcggattctcaaacacaacgtttaaatgatctt
tcgattgtttctcctgaagaagcaactgtagaacccgatgaagtattatcagttattgaa
tctttgaagagaaaaattgcttctgaacgtgctgattatattaagaaaagggtagaagga
aatacacaaaagttggagaatttgacaaaggatctttataatttggcaacagagagaaaa
tgtcttgaaatttttgatgctggcggaaaaaatgatctactatcgaaaagacaaaaggat
gcacttgatatgcaaaatggcattgataccagtaatggagacgatgatagtaatagctct
gaagatgatggatacgccacttctgcaattcttttaggatcaagtattgcagtcaagaat
gctgtacgtcccattaaacttccagaagtaaaacgcatccctccatatacttcatggata
tttttggatagaaatcagagaatgacagaggatcaatctgtggttggtcgtagaagaatt
tattatgaccagaatggtggggaaactttaatttgtagtgatagtgacgaggaagtactt
gaagaagaagaagaaaagaaggtgtttgcagagtccgaagattatatgctgcgaatgact
atcaaagaagttggcttgtccgatattgtgttgggtttgctaggacagtgcttgtctaga
aagcctagtgaagtgaaggcaagatatgaagctcttgttaaggcagatgatgcaggcact
tcaaagaatgagttcacggaaagttctttagatttatatcttgccaaagatcttgatgct
gctctggattcttttgataatctattttgtcgtcgatgtcttgtctttgattgtagatta
catggatgttcacaggatcttatatttcctgcggaaaaacaatcaccatggtactgctcc
aatgcagatatggagccctgtggaccaaattgcttcagcctggccaaaaagttcgaaagt
aatgctacagtgatctctcctcagtgtgctagtcatggagaaaaatccattctgccatct
gatgttgctaataatactcagatgccaggtaggaagcatgtatcaagaagatcaaagtct
tcaaaaggtgaaggtgctccaaatgcaaaaaacatctctgagagcagtgattcagatatt
agacccgtaaatgatatcacttctaatgagcgttcttcatctccatcaaaaagcaaatct
gacaataaagatggcagcaacaaaagaaacagcaagcgaatagctgaacatgttctagtt
gccattaagaaaagacagaagaaaatggcagtattagaatctgatactgttgcaagtgaa
agtctaggtttcaaagatttgaatcttcactctatttcacggaaggaaaatgaagatgcg
agtccatcttcacaaaaagcacaatgtcatagtactaaaaggtctaggaggaaaaactct
ccagttttggacagtaaaaattctttgcaaggcaaggcttttggttgcaaagtgatggaa
gttaacagtgaaaaacctgtggcaaattgtgatgacacattggggaaaaatgaaaaagtg
ggtgagaataactgcaaacaagaagtagatggtactaaatcttggagacccattgaaaag
gctctctttgaaaagggtctagaaatgtttggcagaagcagctgtttgattgctcgaaac
ctcatgaatggtttgaagacatgctgggaggttttccagtacatgaacaattccgggaat
aagctattctcaggcacaggtgatgggatggatggcattcttgaaggtggttgcaatggt
gatggtcaggaaatcatgggtaatgaacctcgaagaagatccagatttttgcgtagaaga
ggcagagttcgccgattaaaatacacgtggaaatccactggataccatgcaattaggaaa
cggatttctgagaggaaggatcaaccctgtcggcagtttaatccatgtggctgtcaaggc
ccctgtggaaaggagtgtccctgtattgtaaatgggacctgctgtgaaaaatactgtgga
tgtccaaagggttgcaagaataggtttcgtggttgtcattgtgccaaaagtcagtgtagg
agccgtcaatgcccttgctttgctgctggtagggaatgtgatcctgatgtttgtcgaaat
tgttggatcagttgtggcgatggtacgcttggggttcctccacaaagaggtgatagtcat
gaatgcaggaatatgaaactacttctcaaacagcaacagaaggtacttctcggaagatct
gatgtttctggttggggggctttcttgaagaatactgttggaaaacatgaataccttggg
gagtacacaggtgaattaatttcacaccgtgaagcagacaagcgtggcaaaatttatgac
cgtgaaaattcttcatttctcttcaatcttaatgatcagtttgtgcttgatgcacaccgg
aaaggtgacaaactaaaatttgcgaaccattctcctgttccaaattgctatgctaaggtc
atgatggtggctggagatcacagagttggtatctttgccaatgaaagaatttgcgctgga
gaagaactcttttatgattatcgttatgagccagacagtgcacctgcctgggcgaggaag
cccgaggcatctggtactaggaaagaggatgctgctccttcaagtggtcgtgctaggaag
catacataa

DBGET integrated database retrieval system