KEGG   Solanum pennellii: 107015466Help
Entry
107015466         CDS       T04130                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP53
  KO
K14826  FK506-binding nuclear protein [EC:5.2.1.8]
Organism
spen  Solanum pennellii
Brite
KEGG Orthology (KO) [BR:spen00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:spen03009]
    107015466
Enzymes [BR:spen01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     107015466
Ribosome biogenesis [BR:spen03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    107015466
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C NPL Nucleoplasmin
Motif
Other DBs
NCBI-GeneID: 107015466
NCBI-ProteinID: XP_015071227
LinkDB All DBs
Position
3
AA seq 482 aa AA seqDB search
MAFWGVELKSGKPFTHNFEKERGRLHISQATLGSGSSNKKCIVQCKVGDKEPIYLCSLLP
EKLETCPLNLEFEEDDDVTFLVVGSHSVHLSGFFYGESEDCCGDEYGSDYEEGASETDSA
SDDSFEFNYDTEDEDEDGSTDDDDFSMYPPSPIPNSGVRIEEILEDEKPTDENGTSKKPK
KKKNQSNGIDDSERQIVVKGNTESPLMESEDEDGFPISAPSENKTKSVRSQKSDGTKDQD
TGEEAGEKKGLKKRLRDDTGKDNDQQGKDIAKQNKKNKKKKVVDGEELDHEDVLKSSANP
EHVEGNDEAFSVGKTEDGQKPTNEKDTEKKKKKKKNKKNQQDGKAVTEVEKDKKNESQEE
NAGTKPSHARTFGNGLVIEELAMGKPDGKKASPGKKVGVRYIGKLKKNGKIFDSNIGKRP
FEFRLGIGQVIKGWDVGVNGMRVGDKRRITIPPAMGYGAKGAGRDIPPNSWLVFDVELVN
VN
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgttctggggagttgaattgaagtctggtaaaccgttcactcacaatttcgaaaaa
gagaggggaagacttcacatctcacaggcaacattaggctcaggctcgtcaaacaaaaaa
tgcatagttcaatgcaaagtaggtgataaggagcctatttacttgtgttcgttattgcca
gaaaaactggagacatgcccgttgaatctcgagtttgaggaggatgatgatgttaccttc
ttagttgttggttctcacagtgttcatctctctggtttcttttacggagagagtgaggat
tgctgtggtgatgaatatggatctgactacgaggaaggtgcttctgagactgatagtgca
tctgatgattcgttcgaattcaattatgacacagaagatgaagatgaagatggctcaact
gacgatgatgattttagcatgtacccaccttcccctattcccaacagtggagtgagaatt
gaagagatactggaggatgaaaagcctacagatgaaaatggtacatccaaaaagccaaag
aagaagaaaaatcagtcaaatgggattgatgactcagagcgccagatagttgtgaagggt
aatactgaaagtcctctgatggagagtgaagatgaggatggctttccgatatctgctccc
tctgaaaacaaaactaaatcagtgagatctcaaaaatcagatggaactaaagatcaggat
acaggtgaggaagcaggtgagaagaaaggcttaaaaaagagacttcgtgatgatactggc
aaagacaatgatcagcaaggaaaagacattgctaagcaaaataaaaagaataagaagaaa
aaggtagtggatggggaggaattggatcatgaggatgttttaaagagcagtgccaatcca
gagcatgtagagggcaatgatgaggcattttcagtaggtaaaactgaagatggtcagaaa
ccaactaatgagaaggatacagagaaaaagaagaaaaagaaaaagaacaagaaaaatcaa
caggatggcaaagctgttacagaggttgaaaaagataagaagaatgaatcacaggaggag
aatgcagggactaagccttctcatgcgaggacctttggaaatggattggtcatagaggag
ctggctatgggcaagccagatgggaaaaaagcttcccctggaaagaaggttggtgtacgt
tatattggcaagctgaagaagaatggcaaaatatttgattccaatattgggaaaagacct
tttgaatttcgcttaggtattggtcaagttataaagggttgggatgttggtgtaaatggc
atgcgtgttggagacaaaagaaggatcacaatcccaccagccatgggttatggggctaaa
ggcgctggtcgtgacataccacccaattcatggctggtatttgatgttgagctggtaaac
gttaattga

DBGET integrated database retrieval system