KEGG   Solanum pennellii: 107016348Help
Entry
107016348         CDS       T04130                                 

Definition
(RefSeq) glutamate decarboxylase 4
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
spen  Solanum pennellii
Pathway
spen00250  Alanine, aspartate and glutamate metabolism
spen00410  beta-Alanine metabolism
spen00430  Taurine and hypotaurine metabolism
spen00650  Butanoate metabolism
spen01100  Metabolic pathways
spen01110  Biosynthesis of secondary metabolites
Module
spen_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:spen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    107016348
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107016348
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107016348
   00430 Taurine and hypotaurine metabolism
    107016348
Enzymes [BR:spen01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     107016348
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Met_gamma_lyase
Motif
Other DBs
NCBI-GeneID: 107016348
NCBI-ProteinID: XP_015072324
LinkDB All DBs
Position
4
AA seq 493 aa AA seqDB search
MVLSKTSSESDVSVHSTFASRYVRTSLPRFEMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLMMSSINKNYVDMDEYPVTTELQNRCVNMIARLFNAPLEEEEAAIG
VGTVGSSEAIMLAGLAFKRNWQNKRKAEGKPYDKPNIVTGANVQVCWEKFANYFEVELKE
VKLREGYYVMDPMKAVEMVDDNTICVAAILGSTLNGEFEDVKLLNDLLIQKNKQTGWDTP
IHVDAASGGFIAPFIYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRTKQDLPEQL
IFHINYLGADQPTFTLNFSKGSSQIIAQYYQLIRLGYEGYRNVMENCRENAIVLREGLEK
TGRFNIVSKDEGVPLVAFSLKDNSLHNEFEVSETLRRFGWIVPAYTMPADAQHITVLRVV
IREDFSRTLAERLVFDIVKVLHELDTLPARLSAKMEENLVIKNNNGKKTEIEVQREVTDF
WKKFVLARKAAVC
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggttctctcaaaaacttcctctgaatctgatgtttctgtacactccacctttgcttct
cgctatgttcgaacttcacttccaaggtttgagatgccagaaaattctatcccaaaagag
gcagcataccaaataattaatgatgagttgatgcttgatggcaatccaaggttgaatttg
gcatcatttgtgacaacatggatggagccagaatgtgataagcttatgatgtcttcaatt
aacaagaattatgttgacatggatgaataccctgttaccactgagcttcagaatcgatgt
gtgaatatgatagcacgtttattcaatgcgcctttagaagaggaagaagcagcaattggt
gttggcacagtggggtcatcagaggccataatgttagcgggcctagccttcaagaggaac
tggcaaaacaaacgcaaagctgagggaaagccttatgataagcccaatattgttactggc
gctaatgttcaggtgtgttgggagaaatttgcaaactactttgaagtggaattgaaagaa
gtaaagctaagggaagggtactatgtgatggacccaatgaaagctgtggaaatggtagat
gacaacaccatttgtgttgctgctattttgggttcaactcttaatggagaatttgaagat
gtcaaactcttgaatgatctgctcattcaaaagaacaagcaaactggatgggatacacca
attcatgtggatgcagcaagtggtggattcattgcaccatttatctacccagagttggaa
tgggactttaggcttcctttagtgaaaagtattaatgtgagtggacacaaatatggactt
gtctatgctggtattggttgggttatttggaggactaaacaagacttgcctgaacaactc
atttttcacatcaattatcttggtgctgatcaacctacttttactctcaatttctccaaa
ggttcaagtcaaatcattgctcaatattatcaacttatccggttgggctacgagggatat
cgaaatgtaatggaaaattgtcgtgaaaacgccattgtgttaagagaaggacttgaaaaa
acaggacgtttcaacatagtctctaaagatgaaggtgtcccattggtggccttttccctc
aaggacaatagtcttcacaacgaatttgaggtctctgagacgctccgtaggttcgggtgg
attgtccctgcctacactatgccagctgacgctcaacacatcacagtgttgcgcgtcgtg
attcgggaggacttctcccgaaccttggcagagcgtctcgtctttgacatcgtcaaagtc
ctccacgagctcgacacgcttccggctaggttgagtgccaaaatggaggagaatttggtg
atcaagaataataatggaaagaaaacagaaattgaagttcaaagggaagttactgatttt
tggaagaagtttgttttagctaggaaagcagctgtttgctag

DBGET integrated database retrieval system