KEGG   Solanum pennellii: 107017006Help
Entry
107017006         CDS       T04130                                 

Definition
(RefSeq) phosphopantothenate--cysteine ligase 2-like
  KO
K01922  phosphopantothenate---cysteine ligase (ATP) [EC:6.3.2.51]
Organism
spen  Solanum pennellii
Pathway
spen00770  Pantothenate and CoA biosynthesis
spen01100  Metabolic pathways
Module
spen_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:spen00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    107017006
Enzymes [BR:spen01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.51  phosphopantothenate---cysteine ligase (ATP)
     107017006
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DFP
Motif
Other DBs
NCBI-GeneID: 107017006
NCBI-ProteinID: XP_015072783
LinkDB All DBs
Position
4
AA seq 327 aa AA seqDB search
MDAVDDANQLQETPKNEVMSFFEPAPLLEDAAEIEKSLKEFVDRNTSSSGNLNGKTNRVV
CITSGGTTVPLEKQCVRYIDNFSSGHRGAASTEYFLKAGYSVVFLYRRGSCQPFCSTLPD
DPLLECFSVADDSSIEVDALHAEIVKRAITENRAAVAEGILLKLSFTTIFEYLQILQLIS
VSLRDFGPSAIFFLAAAVSDFYVPWESMALHKIQSASGPLDIRLAQVPKMLSVLRNEWAP
MAFHISSKLETDTDILLAKANMALKKYKMHMVIANELSTRKEEVIVVTDQEKVTVRRDST
RAGAEVESPLVELVVDRHSTYIKKFDA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggatgcagttgatgatgctaatcagttacaagaaacaccgaaaaatgaagttatgtcc
ttcttcgagccagctcctttactagaggatgctgctgaaattgagaaaagcttgaaggaa
ttcgttgatcgcaatacttcatcatcaggcaatttgaatggaaaaacaaacagggtagtg
tgtattacttcaggtggtacaactgttcctttggaaaagcaatgtgttcgttatatcgac
aactttagctctggtcatagaggggctgcatccacagaatactttctgaaggctggttat
tccgtagtctttctgtatcgaagagggtcatgccaaccattttgtagtactctgcccgat
gatccgctgctagagtgctttagtgttgctgatgattcaagtattgaagtggatgcattg
catgctgaaatagtgaagagagccattactgaaaatcgcgcagcagttgctgagggcatc
ctgttgaaactttcatttacaacaattttcgagtatttgcagattctacagctaatttcc
gtgtctttgagggacttcgggcctagtgctattttttttctggcagctgcagtttctgat
ttttatgttccatgggaaagcatggctttacataaaatccagtcggcatctggtcctctg
gatatacgactcgcccaagtaccaaagatgctttccgtgcttaggaatgaatgggcgcca
atggccttccacatatcgtctaagctagaaacagacacagatatccttttagcaaaggct
aatatggccctcaaaaaatacaagatgcatatggtgatagctaacgaactatcaacccgt
aaagaggaagtaatagttgtcactgatcaggaaaaagtcacagttcgtagggacagcact
cgggcaggggctgaagtcgagtctccgttggttgagcttgttgttgatagacactcaaca
tatatcaagaagttcgatgcataa

DBGET integrated database retrieval system