KEGG   Solanum pennellii: 107017896Help
Entry
107017896         CDS       T04130                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
spen  Solanum pennellii
Pathway
spen00052  Galactose metabolism
spen00500  Starch and sucrose metabolism
spen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107017896
   00500 Starch and sucrose metabolism
    107017896
Enzymes [BR:spen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     107017896
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 107017896
NCBI-ProteinID: XP_015073668
LinkDB All DBs
Position
4
AA seq 897 aa AA seqDB search
MNNHTTNKSCIIIIILSKYFILFFIFLVPFLALITKSEQVGYGYIVRSIGVDSSGRTLTA
YLQLIKNSSVFGTDIQNLTLTACFETKERLRVRITDADHERWEVPREFIPRETHLPPRSS
LLERRSSTSFPLSEDTHYFHTDTVSDLAFTLYNTTPFGFTITRHSTGDVLFDTRPENDSP
DTFLIFKDQYLQLSSSLPANRSSIYGLGEHTKRNFKLKHNQTLTLWNADIASANADLNLY
GSHPFYMDVRSHPGAGTSHGVLLFNSNGMDIVYAGDRITYKVIGGVVDLYFFAGPVPELV
MEQYTELIGRPAPMPYWSFGFHQCRYGYKDITEIKNVVAGYAKAQIPLEVMWTDIDHMDG
YKDFTLDPINFPLDQMKKFVDTLHQNGQKFVLILDPGISINSSYETYKRGMQADVFIKRN
GVPYLGEVWPGKVYFPDFINPRGRVFWSNEIKIFHDLLPVDGLWLDMNELSNFISSPPIP
SSTLDNPPYRINNSGGLRPINEKTVPATSVHFGNTLEYNVHNLYGFLEAKTTNAALIDVT
GKRPFILSRSTFVGSGKYTAHWTGDNAATWDDLAYSIPSVLSSGLFGIPMVGADICGFGR
NTTEELCRRWIQLGAFYPFARDHSEKFTIHQELYIWDSVAATARKVLGLRYRLLPYFYTL
MFEAHTKGVPIARSLFFSFPEDINTYTIDTQFLIGKGLMISPVLTSGAVSVNAYFPSGIW
FNLFNYSDYVNMKSGSYISLDAPPDHINVHLREGNIVVMQGEAMTTRAARDTPFELVVAI
NNWGNSSGEVFLDDGEDVEMGGEGGKWSIVKFHTNVVNKKLYLRSNVVNAEFALSKNWRI
HKVSFLGLKKGVSKINAYNLTTKIRSKVDKSAFGVLEMRGLSVLIGKEFTIELTLKN
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaccacacaactaataaatcttgtattattattattattctctcaaaatatttt
atcttgttcttcatttttttggttccatttttagcacttataacaaaatctgaacaagtt
ggatatggatatattgttagatcaataggcgttgactcatctggaaggacgttgactgct
tatcttcagctcatcaaaaattcctctgtttttggaactgacattcaaaatctcactctt
actgcttgctttgagacgaaagagcgtttaagagtcagaattacggatgctgatcatgaa
agatgggaagttcctcgagaatttatccctcgggaaactcatttacccccccgaagctcc
ctcttggaaaggcgttcttctacctcatttccattatcagaagacacgcactacttccat
acagacactgtttcggaccttgctttcactctctacaacaccaccccttttggctttact
atcacgcgtcactccacaggtgatgttctttttgacaccagacctgagaatgactctcca
gacacgttcctcatcttcaaggatcagtaccttcaattgtcctcctcgttgccagccaat
aggtcatctatttatggtctcggggagcataccaaaagaaattttaagctcaagcataat
cagacattgactctttggaatgctgatattgctagtgctaatgctgatctcaacttgtat
ggttcccaccctttttacatggatgtcaggtctcatcctggcgcggggactagtcacgga
gtcttgctgttcaatagtaatggcatggacattgtatatgctggtgacagaattacttac
aaggtgattggaggggtcgttgacttgtacttctttgctggtcctgtgccagagttggtc
atggaacagtacacagagctcattggccgcccagcgcccatgccatactggtcttttgga
tttcaccaatgccgttatggttataaagacattactgaaattaagaatgtggttgctggc
tatgcgaaagctcagatccctcttgaggtcatgtggacagatattgatcatatggatggt
tacaaggatttcacactcgatcctattaacttcccacttgaccagatgaagaaatttgtc
gatacacttcatcaaaatggccagaaatttgttctcatattggatccaggaatcagcata
aatagctcatatgaaacatacaagagagggatgcaagcagacgttttcatcaaacgcaat
ggtgtcccttatcttggcgaagtttggcctggaaaagtctactttcctgatttcataaat
ccccgagggagagtcttctggagtaatgaaatcaagattttccatgaccttctgcccgtc
gatgggctctggcttgacatgaatgagttatctaacttcatttcttctcctccgatcccc
tcttctacccttgacaaccctccttataggatcaataactcaggaggcttacgtccaata
aacgagaagactgtcccggcaacatcagtacattttgggaataccttagagtacaatgtt
cataacctctacggattcctggaagctaaaacgaccaatgctgctttaatcgatgttact
ggaaaaagaccatttatacttagcagatctacctttgtgggttctgggaagtacacggca
cattggaccggagacaatgcagccacatgggatgacttggcttatagtattcccagcgtt
ttgagttctggactgtttgggattcccatggttggagctgatatatgtggctttggtaga
aatactacagaagaattatgtcgtcgttggattcagctaggtgcattttatccctttgca
agggatcactctgagaagttcactatccatcaagagctatatatctgggattcagtagct
gcaacagccagaaaggtgctcggactacggtatcgtctcttaccatacttctacacgcta
atgttcgaggcccacaccaaaggcgtccctatagcgcgttctcttttcttttcatttccc
gaggatataaacacttacaccatcgacactcagtttctcatcggtaaggggttaatgata
tcaccagtactgacatctggagcagtttcagttaacgcgtatttcccatctggtatctgg
ttcaacctcttcaactattcagattacgtgaacatgaagtccggtagctacatcagtcta
gacgcgcctcctgatcatatcaacgtgcatctcagggagggaaacattgtggtgatgcaa
ggagaagcaatgacaacaagagcagccagggatactccgtttgaacttgttgtcgcgatc
aacaactggggaaatagttcaggggaagtcttcttggacgatggcgaagacgttgaaatg
ggaggagagggaggaaaatggagcatagtgaaatttcacactaatgttgtgaataagaag
ttatatctaagatcaaatgttgtgaatgcagagtttgctttgagtaagaattggagaata
cacaaagtgagttttcttggactcaaaaaaggggtgagtaaaataaatgcatataatctg
actactaaaattagatcaaaagttgataaaagtgcatttggtgttttggagatgagaggt
ctatcagttcttattggaaaagaatttactatagagctaacacttaaaaattaa

DBGET integrated database retrieval system