KEGG   Solanum pennellii: 107019098Help
Entry
107019098         CDS       T04130                                 

Definition
(RefSeq) glutamate decarboxylase-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
spen  Solanum pennellii
Pathway
spen00250  Alanine, aspartate and glutamate metabolism
spen00410  beta-Alanine metabolism
spen00430  Taurine and hypotaurine metabolism
spen00650  Butanoate metabolism
spen01100  Metabolic pathways
spen01110  Biosynthesis of secondary metabolites
Module
spen_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:spen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    107019098
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107019098
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107019098
   00430 Taurine and hypotaurine metabolism
    107019098
Enzymes [BR:spen01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     107019098
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 107019098
NCBI-ProteinID: XP_015075162
LinkDB All DBs
Position
5
AA seq 497 aa AA seqDB search
MVISKAASESDLSVHSTFASRYVRVSLPRFKMPENSIPKDAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMDSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGEGEAAVG
VGTVGSSEAIMLAGLAFKRKWQNKMKAQGKPHDKPNIVTGANVQVCWEKFARYFEVELKE
VKLEDGYYVMDPEKAVEMVDENTICVAAILGSTLNGEFEDVKRLNDLLVEKNKETGWDTP
IHVDAASGGFIAPFIYPEIEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYKNIMENCQENTRVLREGLEK
TERFNIVSKEIGVPLVAFSLKDNSKHNEFEISEHLRRFGWIVPAYTMPANAEHVTVLRVV
IREDFSRTLAERLVGDIVKVLHELDNLPARVTAKLAAIAEGEGSSGHKKSPMEVQLEITN
VWKKFVAEKKKTKNVIC
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggtcatatccaaggccgcctcggagtcggatctctccgtccattccacctttgcttca
cgctatgtccgcgtttctcttccccggtttaagatgccggagaattcgataccaaaggat
gcagcatatcaaataataaatgatgaattaatgttggatggaaatccaaggcttaattta
gcttcatttgtgacaacatggatggaaccagaatgtgataagctaatcatggattcaatt
aacaagaattatgttgacatggatgaataccctgtcaccactgagcttcagaatcgatgt
gtaaacatgatagcccatttatttaatgcaccattgggagagggagaggctgctgttgga
gttggaacagttggatcctcagaagccattatgcttgctggattagcctttaagagaaaa
tggcaaaacaaaatgaaggcccaaggaaagcctcatgacaagcccaatattgttactggg
gccaatgtccaggtatgctgggaaaaatttgcgaggtacttcgaagtagaattaaaagaa
gtgaaattggaggatggatactatgtgatggaccctgagaaagctgtggaaatggttgat
gaaaatactatttgtgttgctgctattttgggttccacacttaatggagaatttgaagat
gtcaagcgtttgaatgatctcttggttgagaagaacaaagaaactgggtgggatactcca
attcatgtggatgcagcaagtggtggattcattgccccatttatatatccagaaattgaa
tgggattttagattaccattagttaaaagtattaatgtgagtggtcataaatatggtctt
gtttatgctggtattggttgggttatttggaggaacaaagaagatttgcctgaagaactt
attttccacatcaattatcttggtgctgatcaacctactttcaccctcaacttctctaaa
ggttctagccaagtaattgcacaatattatcaacttattcgtttaggttacgagggatac
aagaatattatggagaattgtcaagaaaatacaagggtactaagagaaggacttgaaaag
actgaaagattcaacatagtatcaaaagaaattggagtcccattagtagcattttctctc
aaagacaatagtaaacacaacgaattcgagatttctgaacaccttaggaggtttgggtgg
atcgtgccagcttacacgatgccagctaatgctgagcacgtgactgtgctcagggtagtg
attagggaagatttttcccgaacgctagctgagaggctcgtgggggatattgtaaaagtc
ctccacgagctcgataacctcccagcaagagtcacggctaaattagccgcgatcgcggag
ggtgaaggctcatcagggcataagaaatccccaatggaagtgcaattagaaatcaccaat
gtatggaagaagtttgttgctgaaaaaaagaagaccaaaaatgtaatatgttaa

DBGET integrated database retrieval system