KEGG   Solanum pennellii: 107020345
Entry
107020345         CDS       T04130                                 

Definition
(RefSeq) DNA polymerase lambda isoform X1
  KO
K03512  DNA polymerase lambda [EC:2.7.7.7 4.2.99.-]
Organism
spen  Solanum pennellii
Pathway
spen03410  Base excision repair
spen03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    107020345
   03450 Non-homologous end-joining
    107020345
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spen03400]
    107020345
Enzymes [BR:spen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     107020345
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.-  
     107020345
DNA repair and recombination proteins [BR:spen03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     107020345
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    X-family DNA polymerases
     107020345
SSDB
Motif
Pfam: DNA_pol_B_palm DNA_pol_lambd_f DNA_pol_B_thumb HHH_8 HHH_5 BRCT NTP_transf_2 PTCB-BRCT BRCT_2
Other DBs
NCBI-GeneID: 107020345
NCBI-ProteinID: XP_015076151
LinkDB
Position
5
AA seq 554 aa
MTRKKVESPPRDPNGMFSGMVVFFVGTGVMSLRLQIWKRKLLQMGAMFNDQFTENVTHVF
AKDANLLLEKFDKELLIRTKAKFLAYQWLEDSLIQGEKASEDLYVLSLQSGGGESLSPKA
DNDGHSDNDGHSRVTLKKSRISAEDAKNSCPRHVNDNKDRVDPRDTKSASSLASHSSSPE
ATSPEAIHALNKPVGTSDSSSLYKPPDLNRNITQIFGKLLNIYRALGDDRRSFSYYKAIP
VIEKLPFKIESVDQVKHLPSIGKSMQDHIQEIVTTGKLSKLEHFEKDEKVKTISLFGEVW
GVGPSTALKLYEKGHRTLDDLRNEESLTRSQRIGLKYFDDIQTRIQRHEVKEMERLLQKV
GEEILPGVIVVCGGSYRRGMASCGDMDIVITHPDRKSFISDIYLKSMIVLLRSFSHEGFL
PKFVRRLKEIEFLREDLVFTVHSTEGTDSGVDTYFGLCTYPGRELRHRIDLKVYPRDIYA
FGLIAWTGNDVLNRRLRLLAESKGFLLDDTGLYPATHSSAGKRTKGSASMKFETEKQVFE
FLGFPALEPNERNL
NT seq 1665 nt   +upstreamnt  +downstreamnt
atgacgcgaaaaaaggttgaatctccgccgcgtgatcctaatggaatgttttccggtatg
gttgtcttctttgtcggaaccggagttatgtccctccggctacagatatggaagaggaaa
ttgttgcaaatgggggctatgtttaacgaccagttcactgaaaatgtaactcatgttttt
gcaaaagatgcaaatttgcttcttgagaaatttgataaagaacttctgattcgcaccaaa
gctaaatttctcgcgtatcagtggctagaggatagcttaatacaaggagaaaaagcatct
gaggatctgtatgtcttatccctgcaatcaggaggaggagagtcccttagtcctaaagct
gataatgatggtcattctgataatgacggtcattctagagttacactaaagaaaagtcga
atatctgctgaagatgccaagaattcatgcccaagacacgtgaatgacaataaagaccgt
gttgatccacgagatactaaaagtgcctcttcactcgcatcacactcttcaagcccagaa
gcgacaagtcctgaggccattcatgctcttaataagcctgttggaacatcagactcatct
tcactttataagcctccggatttgaaccgaaatatcactcagatattcgggaagcttctc
aacatatatagagcactgggtgatgaccggagatcattcagctattataaagctatacca
gttattgagaaactgccattcaaaattgagagtgtggaccaggttaagcacctaccttct
attggaaagtcaatgcaagatcatattcaggagatagtgaccacaggaaagctgtccaaa
ttggaacactttgagaaggatgaaaaggtaaaaacaatcagcttatttggagaggtttgg
ggtgttggtccatccactgccctaaaactttatgagaaaggacaccgaactcttgatgac
cttagaaatgaggagtcactgactcgttctcaaaggatagggttgaaatattttgatgac
atccagaccaggattcaacggcatgaggtcaaagagatggaacgtttgctacagaaagtt
ggagaagaaattttgcctggtgtgattgttgtgtgtggaggatcatatagacgtggaatg
gcttcttgcggtgatatggatattgttattactcatcctgatagaaaaagtttcatttca
gatatatacttgaaaagcatgatagttttgcttcgttctttcagtcatgaaggctttctt
cctaagtttgtaagacgtctaaaggagatcgagtttttaagagaagatttggtcttcact
gttcatagcacagagggtacagattcaggagttgacacatattttggtctctgcacttat
cctggtcgagaactgcgacatcgtattgacttgaaggtgtatccaagggatatatatgca
tttggactgatagcatggacgggaaatgacgtcttgaatagaaggcttagattgttagct
gaatcgaagggctttcttttggatgatacagggctatatccagctactcatagttctgct
ggaaaacggactaaaggtagtgcaagcatgaagtttgaaactgagaagcaagtgttcgaa
ttccttggatttcccgcgctggaaccaaatgaaaggaatttatga

DBGET integrated database retrieval system