KEGG   Solanum pennellii: 107020534Help
Entry
107020534         CDS       T04130                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
spen  Solanum pennellii
Pathway
spen00010  Glycolysis / Gluconeogenesis
spen00020  Citrate cycle (TCA cycle)
spen00620  Pyruvate metabolism
spen01100  Metabolic pathways
spen01110  Biosynthesis of secondary metabolites
spen01200  Carbon metabolism
Module
spen_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:spen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107020534
   00020 Citrate cycle (TCA cycle)
    107020534
   00620 Pyruvate metabolism
    107020534
Enzymes [BR:spen01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     107020534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 107020534
NCBI-ProteinID: XP_015076426
LinkDB All DBs
Position
5
AA seq 461 aa AA seqDB search
MASLQSSAISFSSSLGRFSATRTMLPQKPRKYKLPVVESKIREIFMPALSSTMTEGKIVS
WVKSEGDVLSKGESVVVVESDKADMDVETFYDGILAVIVVNEGETALVGAPIGLLAETEE
EIAEAKAKAKGQSGGSSSGSESTPEPQSPVGASSDEPKKIVATPNAKKLAKQHKIDINKV
NGTGPFGRITSEDVEKAAGITPAPSKSISPPPAAAAAAAAPAAGAPAKAAPVSLPEIPGS
TVVPFTTMQVAVSKNMVESLSVPTFRVGYPVITDALDALYLKVKKKGVTMTALLAKAAAM
ALAQHPVVNSSCKDGKSFTYNSSINIAVAVAINGGLITPVLQDADKLDLYLLSQKWKELV
EKARAKQLQPHEYNSGTFTLSNLGMFGVDRFDAILPPGQGAIMAVGASKPTPVADADGFF
SVKNKMLVNVTADHRVVYGADLAAFLQTFSKIIENPDSLTM
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcacttcaatcctctgcaatctccttctcatcttcccttggccgtttctcagcc
acacgcacaatgctccctcagaaacccagaaaatacaaactcccagttgttgaatcgaag
attcgagagattttcatgccggcattaagctcaacgatgactgaaggaaagatcgtatct
tgggttaaatcggaaggtgatgttttgtctaaaggtgaatctgtcgttgttgtggagtcg
gataaagctgatatggatgttgagacgttttacgatgggattttagctgttattgttgtt
aacgaaggtgaaactgcacttgttggtgctcctattgggttattagctgaaacagaagag
gaaattgctgaagctaaagctaaagcgaaaggacaatctgggggttcttcttctggatcg
gagagtactcctgaacctcaatctccggttggggcttcttctgatgagccgaagaaaatt
gttgcgaccccaaatgcgaagaaattggcgaagcagcataaaattgatatcaataaagtg
aacgggaccggcccatttggacggattacatcggaggatgttgagaaagctgctggaatt
actccggcaccgtccaagagtattagcccacctcctgctgctgctgctgctgctgctgct
ccggcagcgggtgcgccagctaaagctgctccggttagtttaccagagattcctgggtca
acagttgttccgttcacaacaatgcaagttgcagtgtccaagaatatggtggagagtctc
tctgttccaacatttcgtgttgggtatccagttattactgatgcccttgatgctttatac
ctaaaggtcaagaagaagggtgttacaatgaccgcattgttggccaaagctgcggcaatg
gcactagctcaacatccagttgtgaattcttcttgtaaagatggaaagagctttacgtac
aacagcagtattaatattgctgttgcggtggccattaacggtgggttgataacaccggtg
cttcaggatgctgacaagttggatctgtatctgttgtctcaaaagtggaaggaactggta
gagaaggctagggctaagcaactacaaccacatgagtacaattcagggactttcactttg
tcaaacttgggcatgtttggtgtggaccgatttgatgctattcttcctcctggccagggg
gctataatggctgttggagcatcaaaaccaactcctgtagctgatgctgatgggttcttc
agcgtcaaaaataagatgctggtaaacgtcacagcagatcaccgagttgtgtatggcgcg
gacttagcagccttccttcaaacgttttccaagattattgagaatccagatagcttgaca
atgtag

DBGET integrated database retrieval system