KEGG   Solanum pennellii: 107021301
Entry
107021301         CDS       T04130                                 

Definition
(RefSeq) DNA-repair protein XRCC1
  KO
K10803  DNA-repair protein XRCC1
Organism
spen  Solanum pennellii
Pathway
spen03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    107021301
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spen03400]
    107021301
DNA repair and recombination proteins [BR:spen03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     107021301
SSDB
Motif
Pfam: BRCT PTCB-BRCT BRCT_2 RTT107_BRCT_5
Other DBs
NCBI-GeneID: 107021301
NCBI-ProteinID: XP_015077422
LinkDB
Position
6
AA seq 384 aa
MSGSNDGDKNGRKRNLPSWMSSKPGSSGSGQSKSNDEGETTETAEQAKGRRKTNHGKTLP
DEAENEAHFSNFSKLMEGVVFVLSGFVNPERGTLRSQALEMGAKYQPDWNSESTLLICAF
SNTPKFRQVEADNGTIVSKEWITECYKQRKLVEIETYLMHAGKPWKRQSVSRESSQDQRP
STSRKSQTRGEKSSPFKTTAAPSSEEVHSDKVKDGFSPYKVKKWAINDLNRTISWLENQD
ERPEPHEMKKIAAEGILTCLQDAIDSLNQGQDMRQITEQWECIPRAVEELAKFDGSCVGS
ATMHKDLCKHAVTCKQIYELEYKSREDDELLKMKEQRTRVGGKAGGAAKDAAAYDSDDTV
EMTEEEIDEAYNAVASTIRNSKRV
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgtctgggtcaaacgacggtgacaagaatgggaggaaacgtaatcttccttcatggatg
agttcgaaacccggttcaagtggttcgggtcagagtaaatcaaatgatgaaggtgagacg
acggagacagctgagcaggcgaaaggtagacgcaaaaccaaccatggcaaaacacttccc
gacgaagctgagaacgaagcacatttttcaaatttctcaaaacttatggaaggggttgta
tttgtcctatcaggttttgtcaatcccgagcgtggtacattaaggtcccaggctctagag
atgggagccaagtatcaacctgattggaactcggaatccacacttttgatctgtgcattt
tccaatacaccaaagtttcgtcaagttgaagcagataatggaacaattgtatcgaaggag
tggataacagagtgttacaaacaacgaaaacttgttgaaattgaaacttaccttatgcat
gctggcaagccatggaaacgtcaaagtgtctctcgtgaatccagccaagatcaaagacca
tcaacatcaagaaaatctcaaacaagaggagagaaaagttcaccttttaagacaactgct
gctccttcatctgaggaggtacattctgataaagtaaaagatggtttctctccatataaa
gtgaaaaaatgggctataaatgatcttaatcggacgatttcatggctggagaatcaagat
gaaaggccagagccccatgagatgaagaaaatagctgccgagggaattctaacctgttta
caggatgccatagattctcttaatcaagggcaggatatgcgtcaaataactgaacagtgg
gaatgcatccctcgtgctgttgaggagctggcaaagtttgatggtagttgtgttggttca
gctacaatgcataaggatctttgcaaacatgctgtgacctgtaaacaaatttatgagctg
gagtacaaaagtagggaagacgatgaacttttgaagatgaaagagcagcggactcgtgta
ggtggaaaggctggtggcgctgccaaagatgctgctgcatatgacagtgatgataccgtt
gagatgacagaagaggaaatcgacgaagcttataatgccgtagcatctaccattagaaac
agtaagcgagtgtaa

DBGET integrated database retrieval system