KEGG   Solanum pennellii: 107023295Help
Entry
107023295         CDS       T04130                                 

Definition
(RefSeq) beta-galactosidase 17
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
spen  Solanum pennellii
Pathway
spen00052  Galactose metabolism
spen00511  Other glycan degradation
spen00531  Glycosaminoglycan degradation
spen00600  Sphingolipid metabolism
spen00604  Glycosphingolipid biosynthesis - ganglio series
spen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spen00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    107023295
  Lipid metabolism
   00600 Sphingolipid metabolism
    107023295
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    107023295
   00604 Glycosphingolipid biosynthesis - ganglio series
    107023295
   00511 Other glycan degradation
    107023295
Enzymes [BR:spen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     107023295
Exosome [BR:spen04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107023295
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5
Motif
Other DBs
NCBI-GeneID: 107023295
NCBI-ProteinID: XP_015079424
LinkDB All DBs
Position
6
AA seq 714 aa AA seqDB search
MTTTLKKNGISSFRAVGLRFRAAAMAKKRRVGTTIFMLLLALLAFGAFAPAFAPLPSLSS
FSSRSDIARLNSMGDKNKFEIADDMFWKDGKPFQIIGGDLHYFRVLPEYWEDRLLRAKAL
GLNTIQTYVPWNLHEPREGQLVFKGIADIFSFLNLCQKLDLLVMLRVGPYICAEWDFGGF
PAWLLAIEPAVRLRSSDPAFINLVERWWGILLPKIVSYAYKNGGPIIMVQIENEFGSYGD
DKAYLHHLVRIARGHLGDDVILYTTDGGSRENLNKGTIPGDAVFSAVDFSTGDDPWPNFK
LQKEFNAPGKSPPLSTEFYTGWLTHWGEHIANTDATVTASYLERILSKNGSAVLYMAHGG
TNFGFYSGANTGADETDYKPDLTSYDYDAPIKESGDIDNPKYQALRRVIAKYTAVPLPSV
PSNTEKKAYGLIKLQKTKSLFNIVDTTYFDGVTESENPLAMESLDQMFGFMLYVSDYKAK
ANGGLLFIPKVHDRAQVFISCPSDNYDENPKYVGTVARWSNTSIRLPHTQCTSDNRIYIL
VENMGRINYGKYIFDKKGILSPVYLDGKPLQKWKMLPIPFHNLNEDQNNNSVISDAYADL
RESVQIKLENKRNYHPVPAFYTGHLTVDEVKDTFLSFRGWSKGVAIINGFNLGRFWPSFG
PQCNLYVPAPILQVGKNLVVILELEAPNAELFVTSVDHPDFTCGSSANSRVHQI
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgactacaacactgaagaaaaacggcatttccagtttccgagcagtgggattgagattc
cgagcagcggcaatggcgaaaaaacgacgcgtcggaacgacgatcttcatgctcctctta
gctctcttagcattcggagctttcgcacctgcctttgctccgcttccttctctatcatct
ttttcttcccgttccgacatcgctagacttaattctatgggtgataagaacaaatttgag
attgcggatgatatgttctggaaagatggaaagccttttcagatcattggcggggacttg
cactattttcgggttcttccagagtactgggaagatcgactcctgagagcaaaggcatta
ggcttgaataccattcaaacatatgtcccatggaatttgcacgaaccaagggaaggtcaa
cttgtttttaaaggaatagcagatatcttttcattcctcaatctatgtcagaaattggat
ctcctagtgatgctccgagttgggccttatatttgtgcagagtgggattttgggggtttc
cctgcttggttacttgccattgaacctgctgtaagacttagatcatcagatcctgctttc
attaatttggttgaaagatggtggggaattttgctgccgaagatagtctcttatgcttac
aaaaatggcggccctattataatggttcagatagaaaatgaatttggttcatacggagat
gacaaggcctacctgcatcacttagtgaggatagcccgtggacaccttggagatgatgtt
attctatatacgaccgatggaggttcaagagaaaatcttaacaaagggactattcctgga
gatgctgtcttttcagctgttgatttttcaacgggagatgatccatggcccaattttaag
ttgcagaaagagttcaatgcaccagggaaatcaccaccgctttcaacggagttctacact
ggttggctcacgcactggggagagcatattgcaaatactgatgcaactgttacagcatct
tacttagaaaggatcttgtcaaaaaatggatcagctgtgctctacatggcacatggtgga
acaaatttcgggttctatagtggtgcaaatactggtgcagatgagactgattacaagcct
gatcttacatcctatgattatgatgcacctatcaaagaatctggagatatagacaatcca
aaatatcaagctcttcgaagggtgattgctaaatatactgcagtgcctcttccttcagtt
ccttccaatactgaaaagaaagcatatggacttattaagttgcagaagactaaatcattg
tttaacatagttgataccacatactttgatggtgtcactgaatctgaaaacccacttgca
atggagtctttggaccagatgtttggcttcatgctttatgtttctgattacaaagcaaaa
gctaatggaggtttgttattcataccaaaggtgcatgacagggcacaagtattcatttca
tgcccttcagacaactatgacgaaaatccaaaatatgtaggcactgtagctagatggtca
aatacttccatcaggcttcctcatactcaatgtacttcagataacagaatttatatactg
gtggaaaatatggggcgtataaattatgggaaatacatttttgacaagaagggtatactc
tctcctgtttatttagatggtaaaccattgcagaagtggaaaatgttgccgattcctttt
cacaacctaaatgaggaccaaaacaataattctgttatttcagatgcatacgccgacctt
agagaatctgtgcagataaaactggaaaacaaaagaaattatcatccagtgccagctttc
tacactggtcatcttacagttgatgaagtaaaagacacttttttgtcttttcgtggctgg
agtaaaggggttgcaattatcaatggatttaatttaggaaggttttggccgtcctttgga
ccccagtgcaacctttatgttcctgctccaatcctgcaagtaggaaaaaatctcgtggtt
attctcgaattagaggctccgaatgctgagttgtttgtgacctcagttgaccatccagat
ttcacatgtggttcttccgcaaattcacgagtgcatcaaatctga

DBGET integrated database retrieval system