KEGG   Solanum pennellii: 107023890
Entry
107023890         CDS       T04130                                 

Definition
(RefSeq) proliferating cell nuclear antigen
  KO
K04802  proliferating cell nuclear antigen
Organism
spen  Solanum pennellii
Pathway
spen03030  DNA replication
spen03410  Base excision repair
spen03420  Nucleotide excision repair
spen03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107023890
   03410 Base excision repair
    107023890
   03420 Nucleotide excision repair
    107023890
   03430 Mismatch repair
    107023890
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spen03032]
    107023890
   03400 DNA repair and recombination proteins [BR:spen03400]
    107023890
DNA replication proteins [BR:spen03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    107023890
DNA repair and recombination proteins [BR:spen03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     107023890
   MMR (mismatch excision repair)
    Other MMR factors
     107023890
  TLS (translesion DNA synthesis) factors
   Other TLS factors
    107023890
SSDB
Motif
Pfam: PCNA_C PCNA_N Rad9 Porin_OmpL1
Other DBs
NCBI-GeneID: 107023890
NCBI-ProteinID: XP_015080213
LinkDB
Position
6
AA seq 264 aa
MLELRLVQGSLLKKVLESIKDLVNDANFDCSATGFSLQAMDSSHVALVALLLRSEGFEHY
RCDRNISMGMNLTNMAKMLKCAGNDDIITIKADDGSDTVTFMFESPTQDKIADFEMKLMD
IDSEHLGIPEAEYHAIVRMPSAEFGRICKDLSSIGDTVVISVTKEGVKFSTRGDIGTANI
VCRQNTTVDKPEEATVIEMNEPVSLTFALRYLNSFTKASPLSNTVTISLSSELPVVVEYK
IAEMGYVRYYLAPKIEEDEEETKP
NT seq 795 nt   +upstreamnt  +downstreamnt
atgttggaactacgtctcgttcagggaagtctgctgaagaaagttctagaatcgattaag
gatctggtgaacgatgcgaactttgattgttccgccactggattctctctgcaagccatg
gactccagtcacgtggctctggtggcgctgctgctccgatctgagggttttgagcactac
cgctgtgaccggaacatttcaatgggcatgaaccttactaacatggcgaaaatgctcaaa
tgtgctggaaatgatgacatcatcaccatcaaggctgacgatggcagtgacaccgtcact
ttcatgtttgaaagccccacccaagacaagattgctgattttgagatgaagctaatggac
attgacagtgagcatcttgggattcctgaagcagagtaccatgctattgttagaatgcct
tctgctgagtttggtagaatttgcaaagaccttagcagcattggagatacagttgttatt
tcggtgacaaaggaaggtgtaaaattctcaaccagaggtgacattggtactgctaatatt
gtttgcaggcaaaatacaactgttgacaagcctgaagaagccactgttatagagatgaat
gaaccagtgtcattgacatttgccctaagatacttgaactcctttacaaaagcatctcca
ttgtcaaacacagtgaccatcagcttatcttcagagcttcctgttgttgttgagtacaag
attgctgagatgggttatgtaaggtattacctggcacctaagatagaagaggatgaagag
gaaaccaagccttga

DBGET integrated database retrieval system