KEGG   Solanum pennellii: 107025748
Entry
107025748         CDS       T04130                                 

Definition
(RefSeq) DNA polymerase I B, chloroplastic/mitochondrial
  KO
K02335  DNA polymerase I [EC:2.7.7.7]
Organism
spen  Solanum pennellii
Pathway
spen03030  DNA replication
spen03410  Base excision repair
spen03420  Nucleotide excision repair
spen03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107025748
   03410 Base excision repair
    107025748
   03420 Nucleotide excision repair
    107025748
   03440 Homologous recombination
    107025748
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spen03032]
    107025748
   03400 DNA repair and recombination proteins [BR:spen03400]
    107025748
Enzymes [BR:spen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     107025748
DNA replication proteins [BR:spen03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     107025748
DNA repair and recombination proteins [BR:spen03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA polymerase I
     107025748
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     107025748
SSDB
Motif
Pfam: DNA_pol_A DNA_pol_A_exo1
Other DBs
NCBI-GeneID: 107025748
NCBI-ProteinID: XP_015081985
LinkDB
Position
7
AA seq 1119 aa
MAFLGLSVQSSPFKPTSYVWFSPHSFSSRTFWASSGKALHRGEDCKTRSIENASSSLAVL
GDPIKQISSHERKLFSSGLQQKIEEDSIYGWNAEIDAIKALKAKNAYNSYKKISAANCSV
SASTDRKVKDENSDVPIEVNTRMMRERVTSSYSATTCISGGSLSSKSKPPHNPNRGEKKD
VGNWREYKKHLPQLSVGINHSRNNEVTSINKVDGPNVSHYKPLSKGSNLNEQLSSKIVNA
KFEKANKLWQGSASNQIRDSVNGTDTKVVTVKAKSVILEQATIKREKNAVKSVATDFVNG
TETKIVSDKGTGLDQITLRERLGAMYEKVHIVDNLSAAKEVVSKLTSQYKHLVHACDTEV
ANIDVKQQTPVDHGEVICFSIYSGPEADFGDGKSCIWVDVLDGGGKDLLVEFAPFFQDPS
IRKVWHNYSFDNHVMENYGFEVSGFHADTMHMARLWDSSRRILGGYSLEALTGDSHVMCD
ARLVHAERLFHDEGLFGKISMKTIFGRKKLKKDGTEGKVIMIPSVEELQRTERELWICYS
ALDSISTLMLYESLKKKLSKRIWTFDGVRKGSMYEFYEKYWRPFGEVLVQMETEGVLVDR
AYLAEIEKVAKAEQLVAVNRFRNWAAKYCADAKYMNVGSDTQLRQLFFGGIQNRKNVDES
LPNEKEFKVPNVDKVIEEGKKAPTKFRKIHLHRICDPINTEIFTASGWPSVSGDALKALA
GKVSADFDIFDEVDGNAEEVPETSVDEALTTNNEALSQNPEISAYGTAYHAFGGGQKGIE
ACHAIAALCEVCSIDSLISNFILPLQGHDVSGENGRIHCSLNINTETGRLSARRPNLQNQ
PALEKDRYKIRQAFVAAEGNSLIVADYGQLELRILAHLANCKSMLGAFEAGGDFHSRTAM
NMYSHIREAVEKGQVLLEWHPQPGEDKPPVPLLKDAFGSERRKAKMLNFSIAYGKTTIGL
SRDWKVSVKEAKETVERWYSDRKEVSDWQEQRRFEAREFGCVHTLLGRARWFPSVKNATG
SVKGHIERAAINTPVQGSAADVAMCAMLEISKNARLKELGWKLLLQVHDEVILEGPEESE
KEAMAIVVHCMSNPFNGKNILRVGLSVDAKCAKNWYSAK
NT seq 3360 nt   +upstreamnt  +downstreamnt
atggcatttttgggtctttctgttcaatcttctccttttaaaccaacttcttatgtttgg
ttttctcctcattctttctcttctcgtactttttgggcttcttctggtaaagcccttcac
aggggggaagattgcaaaactcggagtatagaaaatgcatcttccagcttagcggtgctt
ggcgatcccattaaacaaatatcaagtcatgaaaggaagttattctctagtggattacaa
cagaagattgaggaagacagtatttacggatggaatgctgaaattgatgctattaaagct
cttaaagcaaaaaacgcttataatagttataaaaagatttcagcggcaaattgcagtgtt
agcgcctccacagatcggaaggtgaaagatgaaaattctgatgttccaattgaagtcaat
acgagaatgatgcgtgagcgtgtcacctctagctattcagctacaacctgtatttcagga
ggcagcttatcttcaaaaagcaaaccacctcataaccctaatagaggagagaagaaagac
gttgggaactggagagagtataaaaaacatttgcctcaactatctgtaggtatcaaccat
tcaagaaacaatgaagtcacatcaataaataaggttgatggtcctaatgtatctcattac
aaaccattatcaaaaggttccaatcttaatgagcaattatcaagcaaaattgtaaacgcc
aaatttgaaaaagcaaataaactttggcagggtagtgcatctaatcaaataagagacagt
gtgaatgggactgataccaaggtggttactgtcaaagcaaaaagtgttatcctggagcaa
gccactatcaaaagggaaaagaatgcagttaaatcggtggcaactgattttgtgaatgga
actgagactaagattgtcagtgataaaggaacaggtttagatcagattaccctccgtgag
aggctgggtgcaatgtatgaaaaagtgcatatagttgacaatttatctgcagccaaggaa
gttgtcagcaaacttacaagtcagtacaagcatctcgtccatgcatgtgatactgaggta
gcgaatattgatgtcaagcagcaaacacctgttgatcatggagaagttatatgcttcagt
atttattctggaccagaggctgattttggtgatgggaaatcttgtatctgggtagatgtt
cttgatggaggtggcaaggacctattagtcgaatttgctccgtttttccaagacccatcc
atcagaaaggtctggcacaattatagcttcgacaaccacgtaatggaaaattatgggttt
gaagtatctggttttcatgctgacacgatgcacatggcacgactttgggattcctctagg
cgaattttgggtggttattcattagaggcactaacaggtgattctcatgtcatgtgtgat
gctagactagtccatgctgaaaggctgttccatgatgaaggtctgtttggtaaaatatct
atgaaaactatctttggtcggaaaaagctgaagaaagatggaactgagggtaaagtaatc
atgattccttctgtcgaagagttgcaaaggactgaacgagaattgtggatttgttattct
gcattagactccatcagcacattgatgctttatgagagcttgaagaaaaaactatctaaa
cggatctggacattcgatggagttcgtaaaggatccatgtatgaattttatgagaaatac
tggcgtccatttggtgaggttctagttcaaatggaaactgagggtgtgctggttgaccgt
gcctatcttgctgagattgagaaagtcgctaaagctgagcagctggttgctgtgaataga
tttcgtaactgggcagctaagtactgtgctgatgcaaagtacatgaatgttggaagtgac
acacagttgcgtcagctgttttttggtggcatccagaatagaaagaatgttgatgagagt
ctaccaaatgagaaagaattcaaagttccgaatgttgataaagtaattgaagaaggaaag
aaggctcccaccaaatttcgtaaaatccatctacataggatttgtgatcctatcaacact
gagattttcactgccagtggttggccttccgttagtggagatgctttgaaggctctcgct
ggcaaagtttctgcagactttgatatttttgatgaagtggatggcaatgctgaggaagtt
cctgaaacaagcgttgatgaagctttaactacaaataacgaagctctcagtcaaaatcca
gaaatttcagcttatggaacagcctaccacgcctttggaggtgggcagaaaggaattgag
gcatgccatgccattgcagccttatgtgaagtttgctccatagactctttaatatccaac
tttatcctccccttgcagggtcatgatgtgtcaggtgagaatggacggattcattgctcc
ctgaatataaatactgaaactgggcgcttgtctgcaaggagaccaaatttacagaatcag
cctgctcttgagaaagataggtataaaattcggcaagcttttgtagctgcagaggggaat
tccttgattgtggctgactatgggcagttggaactaaggattcttgcacatcttgccaac
tgtaagagcatgttgggtgcattcgaagctggtggagacttccattcaaggactgctatg
aatatgtattctcacatccgtgaagctgttgaaaaggggcaggtacttcttgagtggcat
cctcaaccaggtgaagacaaaccaccagtccctctgctaaaggatgcttttggctctgaa
agaaggaaagcaaagatgctcaatttttcaattgcgtacggaaaaactacaattggactc
tctcgcgattggaaggtatctgtaaaggaagcaaaggaaacagttgaacgttggtatagt
gatagaaaagaagtgtcagattggcaagaacaacgcagatttgaagcacgtgagtttgga
tgtgttcacacacttctaggacgagcacgttggtttccgtcagtaaaaaatgcaaccgga
tccgtaaaaggtcacatagaacgagctgctatcaatactccagtgcagggaagtgctgca
gatgtcgctatgtgcgcgatgttagagatatcaaagaatgcacgactaaaggagcttgga
tggaaattgcttttacaggttcatgatgaagttattttggaaggaccagaagaatctgag
aaagaagccatggcaatagtggttcactgcatgtccaatccgtttaatgggaaaaatatt
ctcagagttggcttatctgtcgatgctaaatgtgctaaaaactggtattctgccaagtag

DBGET integrated database retrieval system