KEGG   Solanum pennellii: 107025804Help
Entry
107025804         CDS       T04130                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase-like
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
spen  Solanum pennellii
Pathway
spen00620  Pyruvate metabolism
spen00710  Carbon fixation in photosynthetic organisms
spen01100  Metabolic pathways
spen01200  Carbon metabolism
Module
spen_M00168  CAM (Crassulacean acid metabolism), dark
spen_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
spen_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
spen_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:spen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    107025804
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    107025804
Enzymes [BR:spen01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     107025804
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 107025804
NCBI-ProteinID: XP_015082029
LinkDB All DBs
Position
7
AA seq 964 aa AA seqDB search
MSRKIEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQDCY
ELSAEYEGKHDPHKLEELGSMLTSLDAGDSIVVTKAFSNMLNLGNLAEEVQIAYRRRSKL
KKRDFSDEASALTESDIEETFKKLVGQLNKSPQEVFDALKNQTVDLVLTAHPTQSVRRSL
LQKHARIRDCMTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMS
YFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRD
VCLLARMMAANLYFSQIEDLMFELSMWRCNDELRVRAEELHRTSKRDAKHYIEFWKKIPP
NEPYRVLLADVRDRLYNTQERARQLLANGYSDVPEESTFTNLEQFLEPLELCYRSLCACG
DRPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDVITRHVGVGSYKEWSEEKRQ
EWLLSELSGKRPLFGPDLPKTDEVADVLDTFHVISELPADSFGAYIISMATAPSDVLAVE
LLQRECHVKSPLRVVPLFEKLADLESAPASVARLFSIDWYRNRINGKQEVMIGYSDSGKD
AGRLSAAWQLYKAQEELVKVAKEFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHGS
LRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMNPPVAPNPEWRALLDEMSVVATKE
YRSLVFQDPRFVEYFRLATPELEYGRMNIGSRPAKRKPSGGIESLRAIPWIFAWTQTRFH
LPVWLGFGAAFKHVTEKDIRNLQMLKDMYNGWPFFRVTLDLLEMVFAKGDPGIAALYDKL
LVSEDLWPLGERLRSKYEETKGFLLQVAGHKDLLEGDPYLRQRLKLRDSYITTLNVSQAY
TLKRIRDPNYNVKVRPHLDKEIMESSKPAAELVKLNPTSEYAPGLEDTLILTMKGIAAGM
QNTG
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atgagtcggaaaattgagaaaatggcttcaattgatgcccaattgaggctattggcacca
gcgaaagtgtcagaggatgataagcttgtggagtatgatgctttgttgcttgacagattt
cttgatattctgcaggatttgcatggagaggatattcgagaaacggttcaagattgttat
gaactatctgctgaatatgaagggaaacatgacccacataagttggaagagcttgggagt
atgcttaccagtttggatgctggggattccattgtagtcaccaaagccttttctaacatg
cttaacttgggtaaccttgctgaagaggttcagatagcttacagacgaagaagtaagcta
aaaaagcgtgatttttcggatgaggcttctgcactaactgaatcagacattgaagagaca
tttaagaagctcgtcggacagctaaacaaatcaccccaagaagtttttgatgctttgaag
aaccagactgtggacttggtgctaacagcacatcctacccagtctgttcgtaggtctttg
cttcaaaagcatgcaaggattcgtgattgtatgacgcagttgtacgccaaagatattact
cctgatgataagcaggagctagacgaggctctacaaagagagatacaagcagcctttcgc
acagatgaaatcaggaggactccaccaactccacaagatgagatgagggcggggatgagt
tacttccatgagacaatatggaagggggtgccgaaattcttacgccgtgttgacactgct
ttgaagaatattggaataaatgaacgtgttccctataatgcccctctcattcagttttct
tcttggatgggtggtgatcgagatggcaaccctagagtaaccccggaagtgacaagagat
gtgtgcttattggctagaatgatggctgcaaatctgtatttctctcagattgaggatctt
atgtttgagctttcaatgtggcgatgcaatgatgagctccgtgtccgtgcagaagaactt
cataggacttccaaaagagatgcaaagcactacattgaattttggaagaaaattccaccg
aatgagccctaccgtgttcttcttgctgatgtgagagataggttatataatacacaggaa
cgagctcgtcagttactagccaatgggtattctgatgttcctgaggagtcgacattcaca
aatcttgaacagtttctggaacctctggagctgtgctatagatctctatgcgcttgtggt
gacagaccaattgcagatggaagccttcttgattttttaaggcaagtgtccacctttggt
ctgtcgcttgtgagacttgatattcgtcaagagtcagatagacacactgatgttctagat
gttataacaaggcacgtgggtgttggctcctataaagaatggtctgaagagaagagacag
gaatggctcttatctgaactaagtggcaagcgtccactttttggacctgatctccctaaa
actgatgaagtcgctgatgttttggatacctttcatgtcatctctgaacttcccgccgac
agtttcggtgcttatataatttcgatggccacggcaccctctgatgtgcttgctgttgag
cttttgcagcgtgaatgtcatgtaaaaagtccattgagggttgttccattgtttgaaaag
cttgctgatctcgagtctgcacctgcttctgttgctcggttgttctccatagattggtac
agaaaccgtatcaatgggaaacaagaagttatgattgggtattctgattcgggtaaggat
gctggccgactatctgcagcttggcaattgtacaaggctcaagaggaacttgtaaaggtg
gcaaaagaatttggagtaaagctaacaatgttccatggccgaggtgggactgtaggaagg
ggagggggtcccacccaccttgctattttatcacaaccccccgacacaattcatggctca
cttcgtgtgactgttcaaggtgaagttattgaacagtcatttggggaggaacacctgtgc
tttagaactcttcagcgtttcacagcagctacacttgagcatggaatgaacccccctgtg
gctccaaatccagagtggcgtgccctattggatgagatgtctgttgttgctacgaaagag
tatcggtctttagtgttccaggatccacgatttgttgaatacttccgccttgcgacccca
gaattagaatatggtcgcatgaacattggaagtcgcccagccaaaaggaagccaagtggt
gggattgaatctcttcgagctattccatggatctttgcatggactcagacaaggtttcat
ctcccagtctggcttggctttggggctgcattcaagcacgttactgagaaggatataaga
aatctgcaaatgctcaaggatatgtacaatggatggcctttctttagagtgacacttgac
ttgctcgaaatggtcttcgctaagggagacccgggtattgctgcattgtatgataaactt
ttagtatccgaagatctgtggccgcttggagagcgattgagatccaaatacgaagaaaca
aagggctttctccttcaggttgctgggcacaaggatctattggaaggagatccatacttg
aggcaaaggctcaaacttcgtgactcttacattacgaccctcaacgtaagccaagcatac
acattgaaacgaattcgtgaccccaactacaatgtgaaggtcagacctcacctagacaag
gagatcatggaatcaagcaaaccagctgctgaattagtgaagctgaatcctacgagcgag
tatgcgcctggtttggaagacaccctcatcttgaccatgaaaggtattgctgctggaatg
cagaacactggttaa

DBGET integrated database retrieval system