KEGG   Solanum pennellii: 107026069Help
Entry
107026069         CDS       T04130                                 

Definition
(RefSeq) probable glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
spen  Solanum pennellii
Pathway
spen00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:spen00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107026069
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spen02000]
    107026069
Enzymes [BR:spen01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107026069
Transporters [BR:spen02000]
 Other Transporters
  Pores ion channels [TC:1]
   107026069
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_2 GST_N_2 GST_C GST_C_3 GST_C_5 GST_C_6
Motif
Other DBs
NCBI-GeneID: 107026069
NCBI-ProteinID: XP_015082398
LinkDB All DBs
Position
7
AA seq 219 aa AA seqDB search
MTDEVVLLGTYVSMFAVRVKIALAEKGIQYEYKEENLVNKSPLLLQMNPIHKKIPVLIHN
GKPICESLIIVEYIDEVWNDKSPLLPSDPYKRAQARFWADYVDKKIYDGGKKIWTTKVED
QEAANKEFIECLKVLEGELGDKPYFDGESFGFVDLALIPYYSWFPAYEKFGKFSIEPECP
KFVAWAKRCMQKENVSKYLSDPDKIYDFVVMLRQRIGIA
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgactgatgaagttgtccttttgggtacttatgtgagtatgtttgctgtgagggtaaaa
attgccctggctgaaaaggggatccaatatgagtacaaagaagagaacttggtgaacaaa
agtcctttactcttacaaatgaatccaattcacaagaaaatcccagtgttgatccataat
ggaaaaccaatatgtgagtcactcataattgttgagtacatagatgaagtttggaatgac
aaatcacctttgttgcctagtgatccttataagagagctcaagctaggttttgggctgat
tatgttgacaaaaagatttatgatggtggaaagaaaatttggacaacaaaagtggaggac
caagaagcagctaataaagaattcattgagtgtttgaaggtgttggaaggggaattggga
gacaagccatacttcgatggagaaagttttggttttgtggatttggcactcattccttac
tatagctggttccctgcttatgaaaaatttggcaaatttagtattgaaccagagtgtcct
aagtttgtggcatgggccaagaggtgtatgcaaaaggagaatgtctctaagtatctttct
gatcctgacaaaatctatgattttgttgtcatgttgagacagaggattggcattgcctaa

DBGET integrated database retrieval system