KEGG   Solanum pennellii: 107026610Help
Entry
107026610         CDS       T04130                                 

Definition
(RefSeq) uncharacterized protein LOC107026610
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
spen  Solanum pennellii
Pathway
spen00061  Fatty acid biosynthesis
spen00780  Biotin metabolism
spen01100  Metabolic pathways
spen01212  Fatty acid metabolism
Module
spen_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:spen00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    107026610
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    107026610
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:spen01004]
    107026610
Enzymes [BR:spen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     107026610
Lipid biosynthesis proteins [BR:spen01004]
 Fatty acid synthase
  Component type
   107026610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT
Motif
Other DBs
NCBI-GeneID: 107026610
NCBI-ProteinID: XP_015083135
LinkDB All DBs
Position
1
AA seq 225 aa AA seqDB search
MASMALSQSVFSTPTSQRFENASFPLPSSMLKQSLVTFRSHSLSTHCKKIRSNVITNCAA
PDSDSKIETPIELRYPAFPTVMDINQIREVLPHRFPFLLVDRVIEYNPGVSAVAIKNVTI
NDNFFPGHFPERPIMPGVLMVEAMAQVGGLVMLQPEVGGSKQNFFFAGIDKVRFRKPVIA
GDTLVMRMTLIKLQKRFGIAKMEGKAYVGGDVVCEGEFLMATGSE
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggcttctatggctctatcccaatctgtcttctccactcccacttctcaaagatttgag
aatgcctcttttccattgccctcatctatgctcaaacaatctcttgttaccttcagatct
cactcactatccacccattgcaagaagatacggagtaatgtcatcaccaactgtgctgct
ccagacagtgattccaaaatcgaaaccccaattgaattgaggtacccagcatttcctact
gtgatggatatcaatcagattcgcgaggttttgccccatcgttttccgtttcttctagtg
gatcgagtgattgaatacaatccaggagtgtcggctgtcgccatcaagaatgtgactatc
aatgataatttctttcctggacacttccctgagaggccaatcatgcctggtgtcctcatg
gttgaggcaatggcccaagttggtggcttggttatgctccaacctgaagttggaggctcc
aaacagaacttcttctttgctggtatagacaaagtaaggttcaggaagccagtgattgct
ggagatactttggtaatgagaatgacactgatcaagctacaaaaacgttttggaatagcc
aagatggaaggtaaggcatatgtaggaggggatgtagtctgtgagggtgaattcttgatg
gctacaggcagtgaataa

DBGET integrated database retrieval system