KEGG   Solanum pennellii: 107029349
Entry
107029349         CDS       T04130                                 

Definition
(RefSeq) high mobility group B protein 1
  KO
K10802  high mobility group protein B1
Organism
spen  Solanum pennellii
Pathway
spen03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    107029349
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spen03036]
    107029349
   03400 DNA repair and recombination proteins [BR:spen03400]
    107029349
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spen04147]
    107029349
Chromosome and associated proteins [BR:spen03036]
 Eukaryotic type
  Nucleosome assembly factors
   HMG (high mobility group) proteins
    107029349
DNA repair and recombination proteins [BR:spen03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     107029349
   MMR (mismatch excision repair)
    Other MMR factors
     107029349
Exosome [BR:spen04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   107029349
SSDB
Motif
Pfam: HMG_box HMG_box_2 YABBY
Other DBs
NCBI-GeneID: 107029349
NCBI-ProteinID: XP_015086227
LinkDB
Position
9
AA seq 175 aa
MKGGKGKGALRKETRSALKPVEDQKMGKRKATLKDAKKKVTKDKKAKKDPNKPKRPPSAF
FVFLEEFRKTFKKENPNVKAVSAVGKAGGEKWKSLSAAEKAPYEAKAAKRKAEYGKLMNA
YNNKQVESSDDEDEEEKEEEKEKRSKPEVHDEDAEDSGQGEEEEEDDEDEEDEDD
NT seq 528 nt   +upstreamnt  +downstreamnt
atgaagggtggaaaaggaaaaggtgcattgagaaaagaaacaaggtcggcgttgaagcct
gttgaggaccaaaagatggggaagagaaaagccacgttgaaggacgccaaaaagaaggtc
acaaaggataaaaaggcaaagaaagatcctaataagcctaagaggcctcccagtgccttt
ttcgtattccttgaggaattcaggaagacatttaaaaaggagaatcctaatgtgaaggct
gtttctgctgtcgggaaagctggaggagaaaagtggaaatctttgagtgcagctgaaaaa
gcaccatatgaagccaaagctgcaaaaaggaaggcagagtatggaaaactcatgaatgct
tataacaataagcaggtggaaagctcagatgatgaggacgaagaagaaaaagaagaagaa
aaagagaaaaggtcaaagcctgaggtacatgatgaagatgcggaggacagtggacagggc
gaagaagaggaagaggacgatgaagacgaagaggatgaagatgattga

DBGET integrated database retrieval system