KEGG   Solanum pennellii: 107029692
Entry
107029692         CDS       T04130                                 

Definition
(RefSeq) adenine DNA glycosylase isoform X2
  KO
K03575  A/G-specific adenine glycosylase [EC:3.2.2.31]
Organism
spen  Solanum pennellii
Pathway
spen03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    107029692
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spen03400]
    107029692
Enzymes [BR:spen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.31  adenine glycosylase
     107029692
DNA repair and recombination proteins [BR:spen03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     107029692
 Prokaryotic type
     107029692
SSDB
Motif
Pfam: HhH-GPD NUDIX_4 HHH
Other DBs
NCBI-GeneID: 107029692
NCBI-ProteinID: XP_015086619
LinkDB
Position
9
AA seq 453 aa
MPVTICLHFETHCLAGNLNERYSVSMEEEKRVMMSLKSKKRARHSRELPPKESDDIEDIS
FSKDETLQIRASLLEWYDENQRDLPWRRISGGSDERDKRGYAVWVSEVMLQQTRVSTVID
YFKRWMNKWPTLHHLAQASLEEVNEMWAGLGYYRRVRFLLQGAKEVVEEGGSFPETVSEL
RKIKGIGEYTAGAIASIAFKKAVPVVDGNVVRVISRLKAISANPKDTATVKSFWKLAGQL
VDPCRPGDFNQALMELGATLCSLSNPGCAVCPISAKCHALSLSRQNESVHVSDYPTKVVK
AKQRHEFSAVSVVEILDCQEMTGSQSNSKYILVKRPNEGLLAGLWEFPSILLEKEADLAS
RRKAIDNFLQSSFNLDLKESTRIVSREDIGEFVHVFSHIRLKMYVELLVLHPKGSLYVLT
YYLMVIEASKTKNWTKRVLHGSMLMAKTLIAWD
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgccagtgaccatttgcttacattttgaaacgcattgcttagcgggaaatctgaatgag
cggtactctgtatcaatggaggaggagaaaagggtgatgatgtcgctgaaaagtaagaag
agagctcggcatagcagagaattacctccaaaagaaagcgatgatatagaggacatcagt
ttctctaaagatgaaaccctacagattagggcttctctattggaatggtatgatgaaaat
caaagagaccttccttggagaagaatcagtggtggttctgatgagagagataaaaggggt
tatgccgtctgggtttctgaagtaatgcttcagcaaactagggtttcaactgtcattgat
tatttcaaacgctggatgaacaaatggcctactcttcatcatcttgctcaagcttctctt
gaggaggtgaatgaaatgtgggctggtttggggtattatagacgagttcgcttcttatta
cagggtgcaaaagaggtggttgaagaaggaggtagttttccagagacagtttcagaactt
cgcaagatcaaaggaattggtgaatacactgctggtgctattgcctcaattgccttcaaa
aaggcagtgcctgttgttgatgggaatgtggtcagggttatttctaggctgaaggccata
tcagcgaatccaaaagacactgcgacagttaagagtttttggaaacttgcaggacaatta
gttgatccttgtaggcctggagatttcaaccaagctcttatggaacttggagctacgttg
tgctctctttcgaatccaggttgtgctgtgtgccccatctctgcgaaatgtcatgctttg
tcgctctctaggcagaatgagtcagttcatgtttcagattatccaacaaaagttgtgaag
gccaaacaaaggcatgagttttctgctgttagtgttgtagagatactggattgccaggaa
atgacgggatctcaatccaacagcaaatatattcttgtaaaaagaccaaatgagggtcta
cttgccggcctctgggagtttccatcaattctcttggagaaggaagcagacctggcctcg
agaagaaaagcgattgataactttttacagtcgtcattcaatctggatcttaaagagtct
actagaatagtttcacgagaagatattggagaatttgtccacgtcttcagtcatatacgc
ctcaagatgtacgtagagttattggtcttacatccaaaaggttcactctatgtgttgact
tactacctcatggtaatcgaagcatcgaagacgaaaaactggacaaagagagtattacat
ggaagtatgttgatggcaaaaaccttgatagcatgggattga

DBGET integrated database retrieval system