KEGG   Solanum pennellii: 107032385
Entry
107032385         CDS       T04130                                 

Definition
(RefSeq) DNA-3-methyladenine glycosylase isoform X1
  KO
K03652  DNA-3-methyladenine glycosylase [EC:3.2.2.21]
Organism
spen  Solanum pennellii
Pathway
spen03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    107032385
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spen03400]
    107032385
Enzymes [BR:spen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     107032385
DNA repair and recombination proteins [BR:spen03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     107032385
 Prokaryotic type
     107032385
SSDB
Motif
Pfam: Pur_DNA_glyco
Other DBs
NCBI-GeneID: 107032385
NCBI-ProteinID: XP_015089462
LinkDB
Position
10
AA seq 288 aa
MTLCYGSCQSWTQICHFNANINPMKKTHRLKNDSNNNITVQKFATKTKASSSKRFKNKQK
SKEYSKPISESEENLPIPQINTTLIAFLDKNPILSRNFYQIDALDLAPRLLGKFLRRDDV
VLQITEVEAYRPNDSACHGRFGKTARTAPVFGPGGHAYVYLCYGLHMMLNVVADKEEAGA
AVLIRSCAPIYGLGTIQQRRGLKTEKPVLLAGPGKVGQALGLSTEWSSHALYTAGGLELL
DGPEPEHILVGPRVGIEYALPEHVNALWRFAIADSSWISAPKKTLRPL
NT seq 867 nt   +upstreamnt  +downstreamnt
atgaccctatgctatggttcttgtcaaagttggacacaaatctgccatttcaatgctaat
attaatccaatgaagaaaacccatcgcttaaaaaacgattcaaataacaatatcactgtt
caaaaatttgccaccaaaaccaaagcttcatcatccaaaagattcaaaaacaagcaaaaa
tcaaaagaatattcaaaacccatatcagaatctgaagaaaacctcccaatacctcaaatt
aacactacccttatagctttcttggataaaaatccaatcttgagtcgaaatttttaccaa
attgatgctcttgatctcgccccacgtttgcttggcaagttccttaggagggatgatgtt
gttcttcagataactgaggtggaagcttataggccaaatgattcagcttgtcatggtcga
tttggcaaaacagcaaggactgcccctgtttttggtcctggtggtcatgcatatgtctac
ctatgctacggtctccacatgatgctcaatgttgtagcagacaaggaagaagccggagca
gctgtattgattcgttcctgcgctcccatctatggtctaggtactattcagcagcgtcgg
ggtttaaaaactgagaaacctgttcttcttgcaggtcccggaaaggttggtcaagcatta
ggactatcaacagaatggtctagccacgctctatacacagctggcggtttagaactctta
gatgggccagaaccagaacatatacttgttggtccaagagtcggtatagagtatgctttg
ccagaacatgttaatgcattgtggagatttgcaatcgccgattcttcatggatcagtgcc
ccaaaaaagactctcagacctctttag

DBGET integrated database retrieval system