KEGG   Spirochaeta perfilievii: EW093_03905
Entry
EW093_03905       CDS       T06210                                 

Definition
(GenBank) HAMP domain-containing histidine kinase
  KO
K14980  two-component system, OmpR family, sensor histidine kinase ChvG [EC:2.7.13.3]
Organism
sper  Spirochaeta perfilievii
Pathway
sper02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sper00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EW093_03905
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sper01001]
    EW093_03905
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sper02022]
    EW093_03905
Enzymes [BR:sper01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     EW093_03905
Protein kinases [BR:sper01001]
 Histidine kinases
  OmpR family
   EW093_03905
Two-component system [BR:sper02022]
 OmpR family
  ChvG-ChvI (acidity sensing)
   EW093_03905
SSDB
Motif
Pfam: HATPase_c HisKA HATPase_c_5
Other DBs
NCBI-ProteinID: QEN03879
UniProt: A0A5C1QAC9
LinkDB
Position
complement(852421..853965)
AA seq 514 aa
MLIHILQELERKLLTSIVTLKELNQFMALDIDIKNKLKRIIYSRILWIIILNAILVFIPI
SGFLIIKSKDYKALNLRSLTNRELSRTIMYGLKDNLSMEYITFIPVIAPYQRVLVINSIN
LKPIYDTRWLTNYAIESFNYDLPFTRIIGESIGDASPPKLSDKEIINRMSKFIKSGENSF
SIIDYRFIYSLSNFSLDNGVKYSLIVLSDKFDLIKNSKIYKIYLLLVSIISILISIIINF
VYYRLIIKPLKVLTNEVKLVKSENKSPKDIFSMRNRVDEIGLLSKAFYITSMELIDQKDS
LRTFSSDVLHELKNPLTGIRNGIEILQINLQDDAISSSMLSLLSKESGRLEKLLFDIREY
SLYDRVDNLSKWCSPSEIIEKLQPLYHKAEIKTFIKTKKRVKLSEPQFISILTNLIDNAL
SFSPEPGSVTIKYYTDGDSPSLLIKDLGPGIPQEEKCKIFRRFYSNRLIVDGEKLHSGLG
LSIVKNILQSNNHTIKCMDNKPKGTIFIVKFSNM
NT seq 1545 nt   +upstreamnt  +downstreamnt
atgttgatacacatattacaagaattagaaagaaaattattaacatctatagtgacttta
aaggaattgaatcagtttatggccttggatatagatataaaaaataagcttaagaggatt
atttatagtagaattctctggattataattctaaatgctatattagtttttattccaata
agtggatttcttattattaagtctaaggattataaggccctaaacctaaggagtttaact
aacagagaattaagtagaaccattatgtacggccttaaagataatctttctatggaatat
attacttttataccagttattgccccatatcaaagagtattagttataaactcaataaat
ttaaaacctatttatgatacaaggtggttaacaaattacgctatcgaatcctttaattat
gatctgccatttactaggataattggagaatctataggggatgcttccccacctaaacta
agtgataaagagattattaataggatgtcaaagtttataaagagtggggaaaatagtttt
agtattatagattaccgttttatatactctcttagtaatttcagtttagataatggggtg
aaatattctctaattgtactctctgataaatttgaccttataaaaaacagtaaaatatac
aaaatctatcttttattagtatctatcatttcaatattaatttctataattattaacttt
gtctattatagattaataattaaaccacttaaagttttaactaatgaagttaagcttgta
aaaagtgaaaataagagcccaaaagatatattttcaatgaggaatagagttgatgagata
ggtcttctatcaaaagccttctatataacatccatggaacttatagatcagaaggattct
cttagaacatttagtagtgatgtgcttcatgaactaaaaaatcctttaacaggtataaga
aatggtattgagattcttcaaataaatttacaagacgatgcaataagtagttccatgtta
tccctattatcaaaggagtcaggaagattagaaaagttattatttgatattagagagtat
agtctctatgatagagtggataacttatctaaatggtgttcccccagtgagataatagaa
aaactacaacctttataccataaagcggaaataaaaacttttattaaaacgaaaaagaga
gttaaactatccgagccccaatttatatctattttaacaaatttaattgataatgcatta
agtttttcccctgagcctgggagtgtaaccataaaatattatacagatggggattcacca
tctcttttaataaaggatttaggtccggggataccccaagaagaaaagtgtaaaatattt
agaagattttattcaaatcggctaatagtagatggagaaaaactacattcaggtctaggg
ttatctattgttaaaaatatattacagagtaataatcacactattaaatgtatggataat
aaacctaaaggtactatctttatagtgaaatttagcaatatgtag

DBGET integrated database retrieval system