KEGG   Staphylococcus pettenkoferi: CEP67_00540Help
Entry
CEP67_00540       CDS       T04943                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
spet  Staphylococcus pettenkoferi
Pathway
spet00020  Citrate cycle (TCA cycle)
spet00190  Oxidative phosphorylation
spet00650  Butanoate metabolism
spet01100  Metabolic pathways
spet01110  Biosynthesis of secondary metabolites
spet01120  Microbial metabolism in diverse environments
spet01130  Biosynthesis of antibiotics
spet01200  Carbon metabolism
Module
spet_M00009  Citrate cycle (TCA cycle, Krebs cycle)
spet_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:spet00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CEP67_00540
   00650 Butanoate metabolism
    CEP67_00540
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CEP67_00540
Enzymes [BR:spet01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CEP67_00540
    1.3.5.4  fumarate reductase (quinol)
     CEP67_00540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 HI0933_like GIDA FAD_oxidored AlaDh_PNT_C NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ASE35843
LinkDB All DBs
Position
114590..116356
Genome map
AA seq 588 aa AA seqDB search
MAEKKIIVVGGGLAGLMSTIKAAEQGAHVDLFSLVPVKRSHSVCAQGGINGAVNTKGEGD
SPWIHFDDTVYGGDFLANQPPVKAMTEAAPKIIHLLDRMGVMFNRTNEGLLDFRRFGGTL
HHRTAYAGATTGQQLLYALDEQVRSFEVDGLVTKYEGWEFLGIVKGEDDSARGIVAQDMT
SSEIKSFGSDAVIMATGGPGIIFGKTTNSMINTGSAASVVYQQGAKYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRIWTYKDGKPWYFLEEKYPDYGNLVPRDIATREIFDVCVNQK
LGINGENMVYLDLSHKDPHELDVKLGGIIEIYEKFTGDDPRKVPMKIFPAVHYSMGGLYV
DYDQMTNIKGLFAAGECDYSQHGGNRLGANSLLSAIYGGTVAGPNAVKYVEDIEDTYKDM
DDSIYERRVQEEQERFDKLLNMKGSENAYKLHKELGEIMTANVTVVRDNKKLLETDKKIQ
ELMKRYEDIDIEDTQTWSNQAVFFTRQLWNMLQLARVITIGAYNRNESRGAHYKPEFPDR
NDEEWLKTTLAEYQGKHEAPKFTYEDVDISFIEPRKRDYTKKSKGGKK
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaaaaaataattgttgtcggtggaggacttgccggtctgatgtcaacaatt
aaagcagcggaacaaggtgcacacgtagatttattctcacttgttccagttaaacgttcg
cactcagtatgtgcgcaaggtggtattaacggggcagttaatacgaaaggtgaaggtgac
tcaccttggattcacttcgacgatacagtatatggtggggacttcttagcaaaccaacca
ccagttaaagcaatgactgaagctgcgccgaagatcatccacttattagaccgtatgggt
gttatgttcaaccgtacaaacgaaggtttattagacttccgtcgtttcggtggaacactt
catcaccgtactgcatacgcaggtgcgactacaggtcaacaacttctttatgcattagac
gaacaagtacgtagctttgaagtagacggcttagtaacgaaatacgaaggatgggaattc
cttggtatcgttaaaggcgaagatgacagtgcgagaggtatcgtagcgcaagatatgact
tcttctgaaatcaaatcattcggttcagatgcggtaatcatggctacaggtggtcctggt
atcatcttcggtaagactacaaactcaatgattaacactggttcagcagcatctgttgtt
taccaacaaggtgcgaaatacgcgaacggtgaatttatccaaatccacccaactgcaatc
cctggtgacgacaaattacgtctcatgagtgagtctgcacgtggtgaaggtggacgtatt
tggacatataaagatggtaaaccatggtacttcttagaagagaaatatccagactatggt
aacttagtaccacgtgacatcgcgacacgtgaaatcttcgatgtctgtgtaaaccaaaaa
ttaggtattaacggtgagaacatggtctaccttgacttatctcacaaagatccacatgag
ttagacgttaaattaggtggtatcatcgagatttacgaaaaattcactggtgatgatcca
cgtaaagtacctatgaaaatcttcccagcagtacactactcaatgggtggtctttacgta
gactacgaccaaatgactaacatcaaaggtctcttcgctgcaggtgaatgtgattactca
caacacggtggtaaccgtttaggtgctaactcactattatcagcaatctacggtggtaca
gttgctggtccaaatgcagtgaaatacgtagaagatatcgaagatacttacaaagacatg
gatgacagtatttatgaacgtcgtgttcaagaagaacaagaacgtttcgataaattactc
aacatgaaaggttcagagaacgcatacaaattgcataaagaacttggtgaaatcatgaca
gctaacgtgacagttgtacgtgataacaagaaattacttgaaacagataagaaaatccaa
gagttaatgaaacgttacgaagatatcgatattgaagatactcaaacttggagtaaccaa
gcagtattcttcactcgccaattatggaacatgttacaattagcacgtgttatcactatt
ggtgcatacaaccgtaatgaatctcgtggtgcacactacaaaccagaattcccagatcgt
aacgacgaagaatggttgaagacaacattagctgaatatcaaggtaagcacgaagcacct
aaattcacttatgaagatgtagatatcagctttattgaacctcgtaaacgtgactacact
aaaaagtctaaaggaggtaaaaaataa

DBGET integrated database retrieval system