KEGG   Staphylococcus pettenkoferi: CEP67_00545Help
Entry
CEP67_00545       CDS       T04943                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
spet  Staphylococcus pettenkoferi
Pathway
spet00020  Citrate cycle (TCA cycle)
spet00190  Oxidative phosphorylation
spet00650  Butanoate metabolism
spet01100  Metabolic pathways
spet01110  Biosynthesis of secondary metabolites
spet01120  Microbial metabolism in diverse environments
spet01130  Biosynthesis of antibiotics
spet01200  Carbon metabolism
Module
spet_M00009  Citrate cycle (TCA cycle, Krebs cycle)
spet_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:spet00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CEP67_00545
   00650 Butanoate metabolism
    CEP67_00545
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CEP67_00545
Enzymes [BR:spet01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CEP67_00545
    1.3.5.4  fumarate reductase (quinol)
     CEP67_00545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_10 Fer4_9 Fer4_17 Fer4_16 Fer4_2 Fer4_18 Fer4 Fer4_13 Fer4_15 Fer4_21 Haemagg_act Fer4_6 Fer4_4
Motif
Other DBs
NCBI-ProteinID: ASE35844
UniProt: A0A1Z3TYM9
LinkDB All DBs
Position
116356..117156
Genome map
AA seq 266 aa AA seqDB search
MAEQTQSQQPQQKQKEPIKLIIKRQDNNESKPYYEEFEIPYKENLNVIACLMYIRRNPVN
AKGEKTTPVTWDMNCLEEVCGACSMVINGQARQSCSAIIDQLEQPIKLEPMSTFPVIRDL
QVDRSRMFDNLKRMKAWVPIDGTYDLGPGPRMPEKKRQTAYELSKCMTCGVCLEVCPNVT
SNNNFVGAQAISQVRLFNLHPTGSMTKDERLDALMGGGGLQACGNSQNCVNACPKGIPLT
TSIAAMNRETSFHMFKSFFGSDHKVD
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacaaactcaaagccaacaacctcaacaaaagcaaaaagagccaattaaatta
atcatcaaacgtcaagataataatgagtctaaaccttattatgaagagtttgagattcca
tataaagagaacttaaacgtgattgcatgtttaatgtacatccgcagaaacccagttaac
gcaaaaggtgaaaaaacaacacctgttacttgggacatgaactgtcttgaagaagtttgt
ggtgcatgttctatggttatcaatggtcaagcacgtcaatcatgttcagcgatcattgat
caattagaacaaccaatcaaacttgaaccaatgagtactttcccagttattcgtgactta
caagttgatcgttctagaatgttcgacaacttgaaacgtatgaaagcttgggtaccaatc
gacggtacttacgatttaggaccaggacctcgtatgcctgagaaaaaacgtcaaacagca
tacgaattatctaaatgtatgacatgtggtgtatgtttagaggtatgtcctaacgtaaca
agcaacaacaacttcgtgggtgcacaagcgatttctcaagttcgcttattcaacttacac
ccaacaggttcaatgactaaagatgaacgtttagatgctttaatgggtggcggaggcctt
caagcatgtggtaactctcaaaactgtgtgaacgcatgccctaaaggtatcccacttaca
acatctatcgcggctatgaacagagaaacttcattccatatgttcaagtcattctttggt
tcagaccacaaagtagactaa

DBGET integrated database retrieval system