KEGG   Staphylococcus pettenkoferi: CEP67_08830Help
Entry
CEP67_08830       CDS       T04943                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
spet  Staphylococcus pettenkoferi
Brite
KEGG Orthology (KO) [BR:spet00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CEP67_08830
Enzymes [BR:spet01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CEP67_08830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like FAD_oxidored Thioredoxin_3 FAD_binding_2 GIDA Thi4 DAO NAD_binding_8 AlaDh_PNT_C NAD_binding_9 K_oxygenase FAD_binding_3 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ASE37387
LinkDB All DBs
Position
complement(1882640..1884163)
Genome map
AA seq 507 aa AA seqDB search
MLNDELKSQLQQLLQLMEGDVVLRASLGSDDKSEELKALLDEVSAMSSQIQVEEASLKRT
PSFTVNRPDEDTGIIFAGIPMGHEFNSFVLALLQVSGRPPKEEQSVLNQIKSLEGPLHFE
TFVSLTCQKCPDVVQALNLMSVVNPNITHTMIDGAVFKDESEDIMAVPAVFLNGEEFGNG
RMSVQDILNQLGSKADPSEFNDKDPYDVLIVGGGPASGTAAIYTARKGLRTGIVADRIGG
QVNDTATIENFVTVKETEGPQFSSALEDHINQYDVDVMKGIQAKGIEKTDDGIEVTLDND
AKLMSKTVIIATGARWRKLQIPGEDRLLNKGVAFCPHCDGPLFEGKDVAVVGGGNSGVEA
AIDLAGIVKNVTLLERNPELKADNVLQERLRELPNVTIVKNAQTTEVLGEDSVTGIQYQD
KETGEEHEIQLDGIFVQIGLLPNTEWLDNYVELNQGNEVMIDRKNATSVPGIFAAGDVTD
DRNKQIIISMGAGANAALNAFDYIIRN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatgatgagttaaagtcacaattacaacaattacttcaactcatggaaggtgac
gttgtcttacgcgcaagtttaggttctgatgacaagtctgaagaacttaaagcgctctta
gacgaagtatcagcgatgtcatctcaaatccaagttgaagaggcatcccttaaacgtaca
ccaagtttcactgtcaatcgacctgatgaggatactggcatcattttcgccggtatccca
atgggtcatgaatttaactctttcgtgctcgcactacttcaagtaagtggtcgtccacct
aaagaagagcaaagtgtgctcaaccaaatcaaatctttagaaggtccacttcactttgag
acattcgtcagtttgacttgtcagaaatgtccagatgtcgttcaagcactcaacttgatg
agtgtcgtgaaccctaacatcacacacactatgattgacggtgcagtcttcaaagacgaa
tccgaagatatcatggctgtacctgctgtctttttaaacggtgaagaattcggcaacgga
cgtatgtctgttcaagatattcttaaccaactcggcagtaaagctgacccttctgaattc
aatgacaaagacccttacgacgtacttatcgtaggcggtggccctgcaagcggtactgca
gcgatttacacagcacgtaaaggtttacgtacaggtatcgttgctgaccgtatcggtggt
caagttaatgatacagctacgattgagaactttgtcactgtgaaagaaacagaaggacct
cagttctcatctgcacttgaagatcacatcaaccaatatgacgtcgatgtgatgaaaggc
attcaagctaaaggtatcgagaagacagacgatggcatcgaagtgacattagacaacgat
gcgaagttaatgagtaagacagtgattatcgcaacaggtgcacgttggcgtaaattacaa
attcctggcgaagatcgtttgcttaacaaaggtgttgcattctgtccacactgtgacggt
cctttatttgaaggtaaagatgtcgcagttgtcggcggaggtaactcaggtgttgaagcc
gcaatcgatttagcaggtattgttaaaaatgtaaccttactcgaacgtaatcctgaattg
aaagcggataacgtattacaagaacgtttaagagaattaccaaacgtaacaattgttaaa
aatgcccaaactactgaagtattaggtgaagatagcgtgacaggcattcaatatcaagac
aaagaaacaggtgaagaacacgagattcaactcgacggaatctttgttcaaatcggttta
ctccctaatacagaatggctcgacaactatgttgagttaaaccaaggtaacgaagtaatg
atcgatcgtaagaatgccacaagcgtaccaggtatctttgcagctggtgacgtgacagac
gatcgcaacaaacaaatcattatttctatgggcgcaggcgcaaacgctgcactcaatgca
ttcgattatattattcgtaattaa

DBGET integrated database retrieval system