KEGG   Streptococcus pyogenes Manfredo (serotype M5): SpyM50332Help
Entry
SpyM50332         CDS       T00497                                 

Definition
(GenBank) putative aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
spf  Streptococcus pyogenes Manfredo (serotype M5)
Pathway
spf00220  Arginine biosynthesis
spf00250  Alanine, aspartate and glutamate metabolism
spf00290  Valine, leucine and isoleucine biosynthesis
spf01100  Metabolic pathways
spf01110  Biosynthesis of secondary metabolites
spf01130  Biosynthesis of antibiotics
spf01210  2-Oxocarboxylic acid metabolism
spf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:spf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SpyM50332
   00290 Valine, leucine and isoleucine biosynthesis
    SpyM50332
   00220 Arginine biosynthesis
    SpyM50332
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spf01007]
    SpyM50332
Enzymes [BR:spf01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SpyM50332
    2.6.1.66  valine---pyruvate transaminase
     SpyM50332
Amino acid related enzymes [BR:spf01007]
 Aminotransferase (transaminase)
  Class I
   SpyM50332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: CAM29675
LinkDB All DBs
Position
369606..370820
Genome map
AA seq 404 aa AA seqDB search
MKIIEKSSKLEHVAYDIRGPVLDEANRMIASGEKILRLNTGNPAAFGFEAPDEVIRDLIV
NARLSEGYSDSKGIFSARKAIMQYCQLKGFPDVDIEDIYLGNGVSELISMSLQALLDNGD
EVLVPMPDYPLWTACVSLGGGKAVHYLCDEEAGWYPDIADIKSKITSRTKAIVVINPNNP
TGALYPKEILEDIVALAREHQLIIFADEIYDRLVMDGKEHIAIASLAPDVFCVSMNGLSK
SHRIAGFRVGWMVLSGPKDHVKGYIEGLNMLANMRLCSNVLAQQVVQTSLGGHQSVDALL
LPGGRIFEQRNFIYEAINAIPGLSAVKPEAGLYLFPKIDRQMYRIDDDEEFVLQLLKQEK
VMLVHGRGFNWKDPDHFRIVYLPSVEELEDVQEKITRVLYQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattattgaaaaatcatcaaaattagaacatgttgcctatgatattcgagggcct
gttttggatgaagctaatcgcatgattgcgagtggtgaaaaaattctgcgtttaaatact
ggcaatcctgctgcctttggttttgaagcaccagatgaagtgattcgtgatttaattgtc
aacgcgaggctaagtgagggctattctgacagtaaagggattttttcagcgcgtaaggct
atcatgcaatattgccaactcaagggcttcccagatgttgacattgaagatatttatttg
ggaaatggcgtgtcagagttgatatccatgtcccttcaagctttgctagataatggcgat
gaagttttagtaccaatgccggattatcctttatggacggcttgtgtgagtcttggtgga
ggaaaagcggtccattatctttgtgatgaagaagctggttggtatcctgatattgctgat
atcaaatcaaaaatcacgagtcgtaccaaagctattgtggtcatcaatcctaataaccca
acaggagctctttatcctaaggagattttagaagacattgttgctttggcaagagaacac
cagctgattatttttgccgatgaaatctatgatcgtttggtgatggatggtaaagagcat
attgctattgcaagcttggcacctgatgttttttgtgtatctatgaatggcctttccaaa
tctcatcgtattgctggttttcgtgttggatggatggtcttatcaggtcctaaagaccat
gttaaaggttacattgaagggttgaacatgcttgccaatatgcggttatgctccaatgtt
ttagcccaacaagttgttcaaacttccttaggaggccatcaatcagttgatgcactgtta
ctgccaggagggcgtatttttgagcaacgtaattttatttatgaagctattaatgctatc
cctggcttatcggcagttaaacctgaagcaggtctttatttatttccgaaaattgatcgt
cagatgtatcgtattgatgatgatgaagaatttgtcttacagttattaaagcaagaaaaa
gtgatgttggtacatggacgtggttttaactggaaagatccagatcacttccgtattgtt
tacctaccaagtgtagaagaattagaagatgttcaagaaaagattacacgtgtcttatac
cagtatagacgttaa

DBGET integrated database retrieval system