KEGG   Streptococcus pyogenes Manfredo (serotype M5): SpyM51227Help
Entry
SpyM51227         CDS       T00497                                 

Gene name
atpD
Definition
(GenBank) ATP synthase beta chain
  KO
K02112  F-type H+/Na+-transporting ATPase subunit beta [EC:7.1.2.2 7.2.2.1]
Organism
spf  Streptococcus pyogenes Manfredo (serotype M5)
Pathway
spf00190  Oxidative phosphorylation
spf01100  Metabolic pathways
Module
spf_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:spf00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SpyM51227 (atpD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:spf00194]
    SpyM51227 (atpD)
Enzymes [BR:spf01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     SpyM51227 (atpD)
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     SpyM51227 (atpD)
Photosynthesis proteins [BR:spf00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   SpyM51227 (atpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N RsgA_GTPase ABC_tran AAA ATPase T3SS_ATPase_C NACHT AAA_25 ATPase_2 AAA_16 AAA_19 RNA_helicase NB-ARC AAA_7
Motif
Other DBs
NCBI-ProteinID: CAM30551
UniProt: A2RFC2
LinkDB All DBs
Position
complement(1229242..1230648)
Genome map
AA seq 468 aa AA seqDB search
MSSGKIAQVVGPVVDVMFASGDKLPEINNALIVYKDSDKKQKIVLEVALELGDGMVRTIA
MESTDGLTRGLEVLDTGRAISVPVGKETLGRVFNVLGETIDLEEPFAEDVDRQPIHKKAP
SFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGIS
VFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVE
GQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTQKGSVTSI
QAIYVPADDYTDPAPATAFAHLDSTTNLERKLTQMGIYPAVDPLASSSRALSPEIVGEEH
YAVATEVQRVLQRYRELQDIIAILGMDELSDEEKTLVGRARRIQFFLSQNFNVAEQFTGL
PGSYVPVADTVRGFKEILEGKYDDLPEDAFRSVGPIEDVIKKAEKMGF
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgagctcaggcaaaattgctcaggttgttggtccagtagtagacgtcatgtttgctagt
ggggacaaacttccagagattaataatgcattgattgtttataaagatagtgataaaaag
caaaaaatcgtccttgaagttgctctggaacttggtgacggtatggtgcgaacaatcgct
atggaatcaactgatgggcttacacgtgggttagaagttcttgacactggtcgtgcgatt
agcgtaccagtaggtaaagaaactttgggacgcgtctttaatgtacttggagaaaccatt
gacttggaagaaccatttgcagaagacgttgaccgtcagccgatccataaaaaagcacca
tcgtttgatgaattatcaacatcatcagaaattcttgaaactggtatcaaggtaattgac
cttcttgccccttaccttaaaggtggtaaagttggacttttcggtggtgccggagttggt
aagactgttcttatccaagaattaatccacaatatcgcccaagaacacggaggtatttca
gtatttaccggtgttggtgagcgaacacgtgaaggaaatgacctttactgggaaatgaaa
gaatcaggcgttattgagaaaactgccatggtttttggtcagatgaatgagccgcctggg
gcacgtatgcgtgtagcccttactggtttaaccattgctgagtatttccgtgatgtagaa
ggccaagatgttttgctctttattgataatatcttccgtttcactcaggcaggttcagaa
gtatcagccctcttaggccgcatgccttctgctgttggttaccaaccgacacttgctact
gaaatgggacaattgcaagaacgtattacgtcaactcaaaaaggatctgttacttctatc
caagcgatttatgtgccagccgatgactatactgacccagcgccagcaactgcatttgct
cacttggattcaacaactaaccttgagcgtaaattgactcaaatgggtatttaccctgcg
gttgacccattggcttcaagttcacgggccttatcacctgaaattgttggtgaagagcac
tatgctgtggcaacagaagttcaacgtgtgcttcaacgctaccgtgaattacaagacatc
atcgctattttggggatggatgaattatcagatgaagaaaaaacattggttggacgtgcg
cgtcgtatccagttcttcttatcacaaaactttaatgttgctgaacaatttacaggtctt
cctggttcttacgtgccagttgctgatacagttcgcggctttaaagaaattcttgaagga
aaatacgatgatcttccagaagacgccttccgttcagttggtccaatcgaggatgtgatt
aaaaaagccgaaaaaatgggcttttaa

DBGET integrated database retrieval system