KEGG   Streptococcus pyogenes Manfredo (serotype M5): SpyM51355Help
Entry
SpyM51355         CDS       T00497                                 

Gene name
tufA
Definition
(GenBank) elongation factor Tu (EF-Tu)
  KO
K02358  elongation factor Tu
Organism
spf  Streptococcus pyogenes Manfredo (serotype M5)
Brite
KEGG Orthology (KO) [BR:spf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:spf03012]
    SpyM51355 (tufA)
   03029 Mitochondrial biogenesis [BR:spf03029]
    SpyM51355 (tufA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spf04147]
    SpyM51355 (tufA)
Translation factors [BR:spf03012]
 Eukaryotic Type
  Elongation factors
   SpyM51355 (tufA)
 Prokaryotic Type
   SpyM51355 (tufA)
Mitochondrial biogenesis [BR:spf03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SpyM51355 (tufA)
Exosome [BR:spf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SpyM51355 (tufA)
  Exosomal proteins of breast cancer cells
   SpyM51355 (tufA)
  Exosomal proteins of colorectal cancer cells
   SpyM51355 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase GrpE
Motif
Other DBs
NCBI-ProteinID: CAM30683
UniProt: A2RFQ4
LinkDB All DBs
Position
complement(1346210..1347406)
Genome map
AA seq 398 aa AA seqDB search
MAKEKYDRSKPHVNIGTIGHVDHGKTTLTAAITTVLARRLPSSVNQPKDYASIDAAPEER
ERGITINTAHVEYETATRHYAHIDAPGHADYVKNMITGAAQMDGAILVVASTDGPMPQTR
EHILLSRQVGVKHLIVFMNKVDLVDDEELLELVEMEIRDLLSEYDFPGDDLPVIQGSALK
ALEGDTKFEDIIMELMDTVDSYIPEPERDTDKPLLLPVEDVFSITGRGTVASGRIDRGTV
RVNDEIEIVGIKEETKKAVVTGVEMFRKQLDEGLAGDNVGILLRGVQRDEIERGQVIAKP
GSINPHTKFKGEVYILSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPAGTEMVMPGDN
VTINVELIHPIAVEQGTTFSIREGGRTVGSGIVSEIEA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaaatacgatcgtagtaaaccccacgttaacattggtacaatcggacac
gttgaccatggtaaaactactttaacagctgcaatcacaactgtattggcacgtcgcttg
ccttcatcagttaaccaaccaaaagattacgcttctatcgatgctgctccagaagaacgc
gaacgcggaatcactatcaacactgcacacgttgagtacgaaactgcaactcgtcactat
gcgcacatcgacgctccaggacacgcggactacgttaaaaacatgatcactggtgccgct
caaatggacggagctatccttgtagttgcttcaacagatggaccaatgccacaaactcgt
gagcacatccttctttcacgtcaagttggtgttaaacaccttatcgtcttcatgaacaaa
gttgaccttgttgatgacgaagagttgcttgaattagttgagatggaaattcgtgacctt
ctttcagaatacgatttcccaggtgatgaccttccagttatccaaggttcagctcttaaa
gctcttgaaggcgacactaaatttgaagacatcatcatggaattgatggatactgttgat
tcatacattccagaaccagaacgcgacactgacaaaccattgcttcttccagtcgaagat
gtattctcaatcacaggtcgtggtacagttgcttcaggacgtatcgaccgtggtactgtt
cgtgtcaacgacgaaatcgaaatcgttggtatcaaagaagaaactaaaaaagctgttgtt
actggtgttgaaatgttccgtaaacaacttgacgaaggccttgcaggagacaacgtaggt
atccttcttcgtggtgttcaacgtgacgaaatcgaacgtggtcaagttattgctaaacca
ggttcaatcaacccacacactaaattcaaaggtgaagtatatatcctttctaaagacgaa
ggtggacgtcacactccattcttcaacaactaccgtccacaattctacttccgtacaact
gacgtaacaggttcaatcgaacttccagcaggtacagaaatggttatgcctggtgataac
gtaacaatcaacgttgagttgatccacccaatcgccgtagaacaaggtactactttctca
attcgtgaaggtggacgtactgttggttcaggtatcgtttcagaaatcgaagcttaa

DBGET integrated database retrieval system