KEGG   Streptococcus pyogenes Manfredo (serotype M5): SpyM51358Help
Entry
SpyM51358         CDS       T00497                                 

Gene name
ppc
Definition
(GenBank) putative phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
spf  Streptococcus pyogenes Manfredo (serotype M5)
Pathway
spf00620  Pyruvate metabolism
spf00680  Methane metabolism
spf01100  Metabolic pathways
spf01120  Microbial metabolism in diverse environments
spf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:spf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SpyM51358 (ppc)
  Energy metabolism
   00680 Methane metabolism
    SpyM51358 (ppc)
Enzymes [BR:spf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SpyM51358 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CAM30686
UniProt: A2RFQ7
LinkDB All DBs
Position
complement(1349204..1351966)
Genome map
AA seq 920 aa AA seqDB search
MPLKKLESSNNQAIIAEEVALLKEMLENITRRMIGDDAFTVIESIMVLSEKQDYIELEKV
VANISNQEMEVISRYFSILPLLINISEDVDLAYEINYQNNTDTDYLGKLALTIKDLAGKD
NGKDILEQVNVVPVLTAHPTQVQRKTILELTTHIHKLLRKYRDAKAGVISLEKWRQELYR
YIEMIMQTDIIREKKLQVKNEIKNVMQYYDGSLIQAVTKLTTEYKNLAQKHGLELDNPKP
ITMGMWIGGDRDGNPFVTAETLCLSATVQSEVILNYYIDKLAALYRTFSLSSTLVQPNSE
VERLASLSQDQSIYRGNEPYRRAFHYIQSRLKQTQIQLTNQPAARMSSSVGLSTSAWSSP
ASLENPILAYDSPVDFKADLKAIEQSLLDNGNSALIEGDLREVMQAVDIFGFFLASIDMR
QDSSVQEACVAELLKGANIVDDYSSLSETEKCDVLVQQLMEEPRTLSSAAVAKSDLLEKE
LAIYTTARELKDKLGEEVIKQHIISHTESVSDMFELAIMLKEVGLVDQQRARVQIVPLFE
TIEDLDNARDIMAAYLSHDIVKSWIATNRNYQEIMLGYSDSNKDGGYLASGWTLYKAQNE
LTAIGEEHGVKITFFHGRGGTVGRGGGPSYDAITSQPFGSIKDRIRLTEQGEIIENKYGN
KDVAYYHLEMLISASINRMVTQMITDPNEIDSFREIMDSIVADSNIIYRKLVFDNPHFYD
YFFEASPIKEVSSLNIGSRPAARKTITEITGLRAIPWVFSWSQNRIMFPGWYGVGSAFKR
YIDRAQGNLERLQHMYQTWPFFHSLLSNVDMVLSKSNMNIAFQYAQLAESQDVRDVFYEI
LDEWQLTKNVILAIQDHDDLLEDNPSLKHSLKSRLPYFNVLNYIQIELIKRWRNNQLDEN
DEKLIHTTINGIATGLRNSG
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
ttgccacttaaaaagttagagagtagtaacaatcaagctatcattgctgaagaagttgct
cttttgaaagaaatgttggaaaatatcacacgacggatgattggagatgacgcgtttaca
gttatcgagtctattatggtgttatctgaaaaacaagattacatagaattagaaaaagtt
gtcgccaatatttcaaatcaagaaatggaagtgatttccaggtatttttctattttaccc
ttgctaatcaatatttcagaagatgtcgatttagcctatgaaattaattatcaaaataat
acggatactgattatttaggaaaattagccctaaccatcaaggatcttgctggaaaagat
aatggtaaagacattttggagcaggttaatgtggttcctgttttaacagcacatccgacg
caagtacaacgtaaaacgattctggaattgacaactcacattcataaacttctgcgcaaa
taccgtgatgctaaggctggtgtgattagtcttgagaaatggcgtcaggagctatatcgt
tatattgaaatgatcatgcagacagatattattcgcgagaaaaagcttcaggtgaaaaac
gagataaaaaatgtcatgcagtattacgatggttctctcattcaagcagtgaccaagttg
acaacagagtacaaaaacttagcccaaaaacacggtctagagttagacaatcccaaaccc
attaccatggggatgtggattggtggggaccgtgatgggaacccctttgtcacagctgaa
accttgtgcttgtcagctacggttcaaagtgaggttatcctcaattactacattgacaaa
ttagcagccctttaccgaacattttcactgtcgtcaaccttggtacaacccaactcggaa
gtggaacgtttagccagtttgtctcaggaccaatcgatttaccgtggaaatgaaccttat
cgcagagcttttcattatattcaatcgcgtcttaaacaaacacaaattcaactaactaat
cagccagcagctcgtatgagtagtagtgtgggactaagcacatctgcttggtcctcacca
gctagtttagaaaatcccatcttagcctatgactctcctgttgattttaaagctgatcta
aaggctattgagcagtcgctacttgataatggcaactccgctttgattgagggggatttg
cgagaagtcatgcaagctgttgatatttttggcttcttcttagcaagcattgacatgagg
caagactccagtgtccaagaagcttgtgtggcagagttattaaaaggagccaatattgtt
gacgattatagctctctttcagaaactgaaaaatgcgatgttctcgtacaacaattaatg
gaggagccaaggaccttatcctcagcggcagttgctaaatcagacctattagaaaaagaa
ctggctatctatactacggcacgagaattgaaagataagcttggagaagaggtcattaag
caacatattatttcacatacagaaagtgtctctgatatgtttgagttggccatcatgctt
aaagaagtgggattggttgaccagcagcgggctcgtgtgcaaattgttcccctctttgaa
accattgaggacttagataatgcccgtgacatcatggcagcctatttaagccatgacatt
gtcaaatcttggattgcaacgaatcgtaattaccaagaaatcatgttaggttattctgac
agtaataaagatggtggctacttggcatcgggttggactctttataaagctcagaatgaa
ttaacggctattggtgaggaacatggagtgaaaatcaccttcttccatggtcgtggagga
acagttggtcgaggaggtggcccttcttatgatgccattacttcacaaccttttggttcc
atcaaagatcggattcgtctgacagagcaaggggaaattattgaaaacaaatacggcaat
aaagatgtggcttattaccatttagaaatgttgatttcagcttctatcaatcgtatggtg
actcaaatgataacagatcctaatgagattgatagttttcgagaaatcatggatagcatt
gttgctgatagcaatatcatttatcgaaaattggtttttgacaatccccatttctatgat
tatttctttgaggcaagcccgattaaggaagtttccagtctcaacattgggtcaagacca
gcagcccgtaaaacgattacggaaattacaggcttgcgtgccattccttgggtcttttca
tggtcacaaaatcgcatcatgttcccaggttggtatggggtaggttcagcctttaaacgt
tatattgaccgagcacaaggtaaccttgaacgcctccaacacatgtatcagacgtggcct
tttttccattccttgttatcaaatgttgatatggtattatctaaatcaaacatgaatatt
gcctttcagtatgcacaactagctgaaagtcaggatgttcgagatgttttttatgagatt
ttggatgagtggcaattgacaaaaaatgttattcttgctatccaagaccatgatgatcta
ttggaggataatccttcccttaagcatagcttgaagtcacgcttgccgtattttaatgtg
ttgaactatattcaaattgaattgattaaacgttggcgtaataatcaacttgacgaaaat
gatgaaaaattgatccatacaactatcaatggcatagcgactggtttacgtaattcaggc
taa

DBGET integrated database retrieval system