KEGG   Streptococcus pyogenes MGAS315 (serotype M3): SpyM3_1071Help
Entry
SpyM3_1071        CDS       T00089                                 

Gene name
sodM
Definition
(GenBank) superoxide dismutase (Mn)
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
spg  Streptococcus pyogenes MGAS315 (serotype M3)
Brite
Enzymes [BR:spg01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SpyM3_1071 (sodM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AAM79678
UniProt: P0DF72
LinkDB All DBs
Position
complement(1113371..1113976)
Genome map
AA seq 201 aa AA seqDB search
MAIILPELPYAYDALEPQFDAETMTLHHDKHHATYVANTNAALEKHPEIGENLEELLADV
TKIPEDIRQALINNGGGHLNHALFWELLSPEKQDVTSDVAQAIDDAFGSFDAFKEQFTAA
ATGRFGSGWAWLVVNKEGQLEITSTANQDTPISEGKKPILALDVWEHAYYLNYRNVRPNY
IKAFFEIINWKKVSELYQAAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggctattattttaccagaacttccatacgcgtatgatgctcttgaaccacagtttgat
gcggagacaatgactcttcatcatgataaacaccatgccacttatgtcgctaataccaat
gcggctttagaaaaacacccagagatcggagaaaatctggaggaactattggcagatgtc
actaagattccagaagatattcgtcaagccttaattaataatggtggaggacacctaaac
catgcgcttttctgggaactattatcacctgaaaaacaagacgtcacttctgatgttgca
caagccattgatgatgcttttgggtcatttgacgcctttaaagaacaatttacagcagct
gctactggacgttttggttcaggttgggcatggttagttgttaataaagaaggacaactc
gaaatcacatcaaccgctaaccaagatactccaatttcagaaggcaaaaaaccaattcta
gcgcttgatgtgtgggagcatgcttactacttgaattatcgtaatgtacgtccaaattat
atcaaagctttctttgaaatcattaattggaaaaaagtatcagaactttaccaagccgct
aaataa

DBGET integrated database retrieval system