KEGG   Streptococcus pyogenes MGAS315 (serotype M3): SpyM3_1369Help
Entry
SpyM3_1369        CDS       T00089                                 

Definition
(GenBank) putative eukaryotic-type serine/threonine kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
spg  Streptococcus pyogenes MGAS315 (serotype M3)
Brite
KEGG Orthology (KO) [BR:spg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spg01001]
    SpyM3_1369
Enzymes [BR:spg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SpyM3_1369
Protein kinases [BR:spg01001]
 Serine/threonine kinases: Other
  Bacterial family
   SpyM3_1369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kdo RIO1 Kinase-like Haspin_kinase FTA2 Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: AAM79976
UniProt: A0A0H2UVV3
LinkDB All DBs
Position
complement(1369188..1371086)
Genome map
AA seq 632 aa AA seqDB search
MIQIGKLFAGRYRILKSIGRGGMADVYLANDLILDNEDVAIKVLRTNYQTDQVAVARFQR
EARAMAELNHPNIVAIRDIGEEDGQQFLVMEYVDGADLKRYIQNHAPLSNNEVVRIMEEV
LSAMTLAHQKGIVHRDLKPQNILLTKEGVVKVTDFGIAVAFAETSLTQTNSMLGSVHYLS
PEQARGSKATIQSDIYAMGIMLFEMLTGHIPYDGDSAVTIALQHFQKPLPSIIEENHNVP
QALENVVIRATAKKLSDRYGSTFEMSRDLMTALSYNRSRERKIVFEDVESTKPLPKVASG
PTASVKLSPPTPTVLTQESRLDQTNQTDALQPPTKKKKSGRFLGTLFKILFSFFIVGVAL
FTYLILTKPTSVKVPNVAGTSLKVAKQELYDVGLKVGKIRQIESDTVAEGNVVRTDPKAG
TAKRQGSSITLYVSIGNKGFDMENYKGLDYQEAMNSLIETYGVPKSKIKIERIVTNEYPE
NTVISQSPSAGDKFNPNGKSKITLSVAVSDTITMPMVTEYSYADAVNTLTALGIDASRIK
AYVPSSSSATGFVPIHSPSSKAIVSGQSPYYGTSLSLSDKGEISLYLYPEETHSSSSSSS
STSSSNSSSTNDSTAPGSNTELSPSETTAQTP
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgattcagattggcaaattatttgctggtcgttatcgcattctgaaatctattggccgc
ggtggtatggcggatgtttatttagcaaatgatttgatcttagataatgaagacgttgca
atcaaggtcttgcgtaccaattatcaaacagatcaggtagcagttgcgcgtttccaacga
gaagcgcgagccatggctgaattgaaccatcccaatattgttgccatccgggatataggt
gaagaagacggacagcaatttttagtaatggaatatgtggatggtgctgatctaaagaga
tacattcaaaatcatgctccattatctaataatgaagtggttagaattatggaagaagtc
ctttctgctatgactttagcccaccaaaaaggaattgtacacagagatttaaaacctcaa
aatatcctactaactaaggagggtgttgtcaaagtaactgatttcggcatcgcagtagcc
tttgcagaaacaagcttgacacaaactaattcgatgttaggcagtgttcattacttgtct
ccagaacaggctcgcggctccaaagctacgattcaaagtgatatttatgcgatggggatt
atgctctttgagatgttgacaggccatatcccttatgatggcgatagtgctgttacgatt
gccttgcaacattttcaaaagcctcttccatctattatcgaggagaaccacaatgtgcca
caagctttggagaatgttgttattcgagcaacagccaagaaattaagtgatcgttacgga
tcaacctttgaaatgagtcgtgacttaatgacggcgcttagttataatcgtagtcgggag
cgtaagattgtctttgaggatgttgaaagtaccaaacccctccccaaagtggcctcaggt
cccaccgcttctgtaaaattgtctccccctaccccaacagtgttaacacaggaaagtcga
ttggatcaaactaatcaaacagatgctttacagccccccaccaaaaagaaaaaaagtggt
cgttttttaggtactttattcaaaattcttttttctttctttattgtaggtgtagcactc
tttacttatcttatactaactaaaccaacttctgtgaaagtgcctaatgtagcaggcact
agtcttaaagttgccaaacaagaactgtatgatgttgggctaaaagtgggtaaaatcagg
caaattgagagtgatacggttgctgagggaaatgtagttagaacagatcctaaagcagga
acagctaagaggcaaggctcaagcattacgctttatgtgtcaattggaaacaaaggtttt
gacatggaaaactacaaaggactagattatcaagaagctatgaatagtttgatagaaact
tatggtgttccaaaatcaaaaatcaaaattgagcgcattgtaactaatgaatatcctgaa
aatacagtcatcagtcaatcgccaagtgcgggtgataaatttaatccaaacggaaagtct
aaaattacgctcagtgttgctgttagtgatacgatcactatgcctatggtaacagaatat
agttatgcagatgcagtcaataccttaacagctttaggtatagatgcatctagaataaaa
gcttatgtgccaagctctagctcagcaacgggctttgtgccaattcattctcctagttct
aaagctattgtcagtggtcaatctccttactatggaacgtctttgagtctgtctgataaa
ggagagattagtctttacctttatccagaagaaacacactcttctagtagctcatcgagt
tcaacgtcaagttcaaacagttcttcaacaaatgatagtactgcaccaggtagcaacact
gaattaagcccatcagaaactactgctcaaacaccttaa

DBGET integrated database retrieval system