KEGG   Streptococcus pyogenes MGAS315 (serotype M3): SpyM3_1545Help
Entry
SpyM3_1545        CDS       T00089                                 

Definition
(GenBank) putative aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
spg  Streptococcus pyogenes MGAS315 (serotype M3)
Pathway
spg00220  Arginine biosynthesis
spg00250  Alanine, aspartate and glutamate metabolism
spg00290  Valine, leucine and isoleucine biosynthesis
spg01100  Metabolic pathways
spg01110  Biosynthesis of secondary metabolites
spg01130  Biosynthesis of antibiotics
spg01210  2-Oxocarboxylic acid metabolism
spg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:spg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SpyM3_1545
   00290 Valine, leucine and isoleucine biosynthesis
    SpyM3_1545
   00220 Arginine biosynthesis
    SpyM3_1545
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spg01007]
    SpyM3_1545
Enzymes [BR:spg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SpyM3_1545
    2.6.1.66  valine---pyruvate transaminase
     SpyM3_1545
Amino acid related enzymes [BR:spg01007]
 Aminotransferase (transaminase)
  Class I
   SpyM3_1545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AAM80152
UniProt: A0A0H2UWD5
LinkDB All DBs
Position
complement(1534925..1536139)
Genome map
AA seq 404 aa AA seqDB search
MKIIEKSSKLEHVAYDIRGPVLDEANRMIASGEKILRLNTGNPAAFGFEAPDEVIRDLIV
NARLSEGYSDSKGIFSARKAIMQYCQLKGFPDVDIEDIYLGNGVSELISISLQALLDNGD
EVLVPMPDYPLWTACVSLGGGKAVHYLCDEEAGWYPDIADIKSKITSRTKAIVVINPNNP
TGALYPKEILEDIVALAREHQLIIFADEIYDRLVMDGKEHIAIASLAPDVFCVSMNGLSK
SHRIAGFRVGWMVLSGPKDHVKGYIEGLNMLANMRLCSNVLAQQVVQTSLGGHQSVDALL
LPGGRIFEQRNFIYEAINAIPGLSAVKPEAGLYLFPKIDRQMYRIDDDEEFVLQLLKQEK
VMLVHGRGFNWKDPDHFRIVYLPSVEELEDVQEKITRVLYQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattattgaaaaatcatcaaaattagaacatgttgcctatgatattcgagggcct
gttttggatgaagctaatcgcatgattgcgagtggtgaaaaaattctgcgtttaaatact
ggcaatcctgctgcttttggttttgaagcaccagatgaagtgattcgtgatttaattgtc
aacgcgaggctaagtgagggctattctgacagtaaagggattttttcagcgcgtaaggct
atcatgcagtattgtcaactcaagggcttcccagatgttgacattgaagatatttatttg
ggaaatggcgtgtcagagttgatatccatatcccttcaagctttgctagataatggcgat
gaagttttagtaccaatgccggattatcctttatggacggcttgtgtgagtcttggtgga
ggaaaagcggtccattatctttgtgatgaagaagctggttggtatcctgatattgctgat
atcaaatcaaaaatcacgagtcgcaccaaagctattgtggtcatcaatcctaataaccca
acaggagccctttatcctaaggagattttagaagacatcgttgctttggcaagagaacac
cagctgattatttttgccgatgaaatctatgatcgtttggtgatggatggtaaagagcat
attgctattgcaagtttggcacctgatgttttttgtgtatctatgaatggtctttccaaa
tctcatcgtattgctggttttcgtgttggatggatggtcttatcaggtcctaaagaccat
gttaaaggttacattgaagggttaaacatgcttgccaatatgcggttatgctccaatgtt
ttagcccaacaagttgttcaaacttccttaggaggtcatcaatcagttgatgcactgtta
ctgccaggagggcgtatttttgagcaacgtaattttatttatgaagctattaatgctatc
cctggcttatcggcagttaaacctgaagcaggtctttatttatttccgaaaattgatcgt
cagatgtatcgtattgatgatgatgaagaatttgtcttacagttattaaagcaagaaaaa
gtgatgttggtacatggacgtggttttaactggaaagatccagatcacttccgtattgtt
tacctaccaagtgtagaagaattagaagatgtccaagaaaagattacacgtgtcttatac
cagtatagacgttaa

DBGET integrated database retrieval system