KEGG   Streptococcus pyogenes MGAS315 (serotype M3): SpyM3_1563Help
Entry
SpyM3_1563        CDS       T00089                                 

Gene name
alr
Definition
(GenBank) putative alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
spg  Streptococcus pyogenes MGAS315 (serotype M3)
Pathway
spg00473  D-Alanine metabolism
spg01100  Metabolic pathways
spg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:spg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SpyM3_1563 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    SpyM3_1563 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:spg01011]
    SpyM3_1563 (alr)
Enzymes [BR:spg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SpyM3_1563 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:spg01011]
 Precursor biosynthesis
  Racemase
   SpyM3_1563 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AAM80170
UniProt: P0CZ56
LinkDB All DBs
Position
complement(1559799..1560899)
Genome map
AA seq 366 aa AA seqDB search
MISSFHRPTVARVNLQAIKENVASVQKHIPLGVKTYAVVKADAYGHGAVQVSKALLPQVD
GYCVSNLDEALQLRQAGIDKEILILGVLLPNELELAVANAITVTIASLDWIALARLEKKE
CQGLKVHVKVDSGMGRIGLRSSKEVNLLIDSLKELGADVEGIFTHFATADEADDTKFNQQ
LQFFKKLIAGLEDKPRLVHASNSATSIWHSDTIFNAVRLGIVSYGLNPSGSDLSLPFPLQ
EALSLESSLVHVKMISAGDTVGYGATYTAKKSEYVGTVPIGYADGWTRNMQGFSVLVDGQ
FCEIIGRVSMDQLTIRLSKAYPLGTKVTLIGSNQQKNISTTDIANYRNTINYEVLCLLSD
RIPRIY
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaagtttccatcgcccaacagttgcaagggtcaatttacaagctattaaggag
aatgttgccagtgttcaaaagcatattccactaggggtaaaaacgtatgcagttgtcaag
gctgatgcttatggtcatggtgctgtccaggtgtcaaaagcactcctacctcaagtggat
gggtactgtgtgtcaaatcttgatgaggctttgcaattacgtcaagcaggtattgataaa
gagattttaattcttggggtcctcctgccaaatgaattagagttagcagttgctaatgct
attactgttacaatcgctagtttagactggatagctttagctagactggagaaaaaagaa
tgtcaaggcttaaaagttcatgtaaaagttgattctggtatggggcggatcgggcttcgt
tcttcaaaagaagtcaatttattgattgatagtctaaaagagttgggtgctgatgtagaa
ggtatttttactcattttgccacagctgatgaggcagatgatactaaatttaaccagcag
ttacagttttttaaaaagctgatagctggacttgaggataagcctcgtttagtacatgct
agtaattcagccacaagtatctggcatagtgataccatttttaatgctgttcgtttagga
attgtcagttatggtttgaatccaagtggttctgatctaagcttaccatttccactgcaa
gaggctttatctctagaatctagcttagtgcatgtcaagatgatttcagctggtgataca
gtcggttatggagctacttatactgccaaaaagtctgaatatgtagggaccgtcccaatc
ggttatgcagatggctggaccaggaacatgcaaggcttttcggtgttagttgatggacaa
ttctgtgaaattatagggcgtgtatcgatggatcaactgaccatacgactttccaaagca
tatcctttaggaacaaaagtcactttgattggcagcaatcagcaaaaaaatatttctaca
acagatatcgcaaattaccgtaatacaatcaattatgaagttctatgccttttaagtgac
cgtattcctcggatatattaa

DBGET integrated database retrieval system