KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy0305Help
Entry
MGAS10270_Spy0305 CDS       T00355                                 

Definition
(GenBank) Ribosomal large subunit pseudouridine synthase B
  KO
K06178  23S rRNA pseudouridine2605 synthase [EC:5.4.99.22]
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
Brite
KEGG Orthology (KO) [BR:sph00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sph03009]
    MGAS10270_Spy0305
Enzymes [BR:sph01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.22  23S rRNA pseudouridine2605 synthase
     MGAS10270_Spy0305
Ribosome biogenesis [BR:sph03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    MGAS10270_Spy0305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 S4_2 ThiS
Motif
Other DBs
NCBI-ProteinID: ABF33370
UniProt: Q1JIF3
LinkDB All DBs
Position
319524..320270
Genome map
AA seq 248 aa AA seqDB search
MLKRKKNIMRINKYIAHAGIASRRKAEELIKQGLVTLNGQVITDLATTVKSGDVVEIEGS
PIYNEEKVYYLLNKPRGAISSVSDDKGRKTVLDLLPQVKERIYPVGRLDWDTSGVLILTN
DGDFTDTMIHPRNEIDKVYLARVKGIATKENLRPLTRGIVIDGKKTKPARYNIVRVEADK
NRSIVELTIHEGRNHQVKKMFESVGLLVDKLSRTRFGTVDLKGLRPGEARRLNKKEISQL
HNLANTKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
ttgctcaaaagaaagaagaatataatgcgaattaacaaatacattgcccatgcgggtatt
gccagtcgacgtaaggctgaagaattgattaagcaaggcttagtaaccttaaatggtcag
gttattacggatttagcaaccactgtaaaatcgggagacgtggttgaaatagaaggaagt
cctatttacaacgaggaaaaggtttactatttgcttaataaacctcgtggcgctatctca
agtgtgtcagatgacaaaggccgtaaaacggtactggatttactacctcaggttaaagaa
cgcatataccctgttggacgattggattgggacacatcaggggtccttattttaacgaat
gatggtgattttacagatactatgattcatcctagaaatgaaatagacaaggtttatctg
gcacgtgtcaaaggaattgcaacgaaagaaaatcttcgtcccttaactcgaggaattgtt
attgatggtaaaaagaccaaaccagctcgctacaatattgttcgtgtagaagctgataag
aatcgatcgatcgtagaattgactatccatgaagggcgaaaccatcaagtgaaaaaaatg
tttgagtctgtggggcttttggttgataaattatctcgtacacgttttgggaccgtcgac
ttaaagggactaagaccaggagaagcaagacgcttaaataaaaaagaaataagtcaactg
cataacttagctaatacgaaaaaatga

DBGET integrated database retrieval system